Lineage for d1edg__ (1edg -)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 64292Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 64720Superfamily c.1.8: (Trans)glycosidases [51445] (8 families) (S)
  5. 64889Family c.1.8.3: beta-glycanases [51487] (14 proteins)
  6. 64979Protein Endoglucanase CelA [51491] (1 species)
  7. 64980Species Clostridium cellulolyticum [TaxId:1521] [51492] (1 PDB entry)
  8. 64981Domain d1edg__: 1edg - [28807]

Details for d1edg__

PDB Entry: 1edg (more details), 1.6 Å

PDB Description: single crystal structure determination of the catalytic domain of celcca carried out at 15 degree c

SCOP Domain Sequences for d1edg__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1edg__ c.1.8.3 (-) Endoglucanase CelA {Clostridium cellulolyticum}
mydaslipnlqipqknipnndgmnfvkglrlgwnlgntfdafngtnitneldyetswsgi
kttkqmidaikqkgfntvripvswhphvsgsdykisdvwmnrvqevvnycidnkmyviln
thhdvdkvkgyfpssqymasskkyitsvwaqiaarfanydehlifegmneprlvghanew
wpeltnsdvvdsincinqlnqdfvntvratggknasrylmcpgyvaspdgatndyfrmpn
disgnnnkiivsvhaycpwnfaglamadggtnawnindskdqsevtwfmdniynkytsrg
ipviigecgavdknnlktrveymsyyvaqakargilcilwdnnnfsgtgelfgffdrrsc
qfkfpeiidgmvkyafglin

SCOP Domain Coordinates for d1edg__:

Click to download the PDB-style file with coordinates for d1edg__.
(The format of our PDB-style files is described here.)

Timeline for d1edg__: