Lineage for d1uok_2 (1uok 1-479)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 18710Superfamily c.1.8: (Trans)glycosidases [51445] (7 families) (S)
  5. 18711Family c.1.8.1: alpha-Amylases, N-terminal domain [51446] (11 proteins)
  6. 18825Protein Oligo-1,6, glucosidase [51476] (1 species)
  7. 18826Species Bacillus cereus [TaxId:1396] [51477] (1 PDB entry)
  8. 18827Domain d1uok_2: 1uok 1-479 [28788]
    Other proteins in same PDB: d1uok_1

Details for d1uok_2

PDB Entry: 1uok (more details), 2 Å

PDB Description: crystal structure of b. cereus oligo-1,6-glucosidase
PDB Compounds: ( :)

SCOP Domain Sequences for d1uok_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uok_2 c.1.8.1 (1-479) Oligo-1,6, glucosidase {Bacillus cereus}
mekqwwkesvvyqiyprsfmdsngdgigdlrgiiskldylkelgidviwlspvyespndd
ngydisdyckimnefgtmedwdellhemhernmklmmdlvvnhtsdehnwfiesrkskdn
kyrdyyiwrpgkegkepnnwgaafsgsawqydemtdeyylhlfskkqpdlnwdnekvrqd
vyemmkfwlekgidgfrmdvinfiskeeglptveteeegyvsghkhfmngpnihkylhem
neevlshydimtvgempgvtteeaklytgeerkelqmvfqfehmdldsgeggkwdvkpcs
lltlkenltkwqkalehtgwnslywnnhdqprvvsrfgndgmyriesakmlatvlhmmkg
tpyiyqgeeigmtnvrfesideyrdietlnmykekvmergediekvmqsiyikgrdnart
pmqwddqnhagfttgepwitvnpnykeinvkqaiqnkdsifyyykklielrknneivvy

SCOP Domain Coordinates for d1uok_2:

Click to download the PDB-style file with coordinates for d1uok_2.
(The format of our PDB-style files is described here.)

Timeline for d1uok_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1uok_1