![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.96: Flavivirus non-structural protein NS2B-like [310561] (1 superfamily) |
![]() | Superfamily g.96.1: Flavivirus non-structural protein NS2B-like [310588] (2 families) ![]() Pfam PF01002; see PubMed 16532006 for discussion of NS2B-NS3pro complex |
![]() | Family g.96.1.1: Flavivirus non-structural protein NS2B-like [310635] (2 proteins) |
![]() | Protein automated matches [310851] (1 species) not a true protein |
![]() | Species West Nile virus [TaxId:11082] [311209] (3 PDB entries) |
![]() | Domain d2ijoa_: 2ijo A: [287879] Other proteins in same PDB: d2ijob1, d2ijoi_ automated match to d2fp7a_ |
PDB Entry: 2ijo (more details), 2.3 Å
SCOPe Domain Sequences for d2ijoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ijoa_ g.96.1.1 (A:) automated matches {West Nile virus [TaxId: 11082]} stdmwiertadiswesdaeitgsservdvrldddgnfqlmn
Timeline for d2ijoa_: