SCOPe 2.08: Domain d1amya2: 1amy A:1-346

Lineage for d1amya2 (1amy A:1-346)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
   members of the family may contain various insert subdomains
   in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain

6. Protein Plant alpha-amylase [51474] (2 species)

7. Species Barley (Hordeum vulgare), seeds, AMY2 isozyme [TaxId:4513] [51475] (3 PDB entries)

8. Domain d1amya2: 1amy A:1-346 [28786]
   Other proteins in same PDB: d1amya1
   complexed with ca

Details for d1amya2

PDB Entry: 1amy, 2.8 Å

PDB Description: crystal and molecular structure of barley alpha-amylase

PDB Compounds: (A:) 1,4-alpha-d-glucan glucanohydrolase

SCOPe Domain Sequences for d1amya2:

Sequence; same for both SEQRES and ATOM records:

>d1amya2 c.1.8.1 (A:1-346) Plant alpha-amylase {Barley (Hordeum vulgare), seeds, AMY2 isozyme [TaxId: 4513]}
qvlfqgfnweswkhnggwynflmgkvddiaaagithvwlppasqsvaeqgympgrlydld
askygnkaqlksligalhgkgvkaiadivinhrtaehkdgrgiycifeggtpdarldwgp
hmicrddrpyadgtgnpdtgadfgaapdidhlnlrvqkelvewlnwlkadigfdgwrfdf
akgysadvakiyidrsepsfavaeiwtslayggdgkpnlnqdqhrqelvnwvdkvggkgp
attfdfttkgilnvavegelwrlrgtdgkapgmigwwpakavtfvdnhdtgstqhmwpfp
sdrvmqgyayilthpgtpcifydhffdwglkeeidrlvsvrtrhgi

Timeline for d1amya2:

• d1amya2 first appeared (with stable ids) in SCOP 1.55, called d1amy_2
  
• d1amya2 appears in SCOPe 2.07