Lineage for d1avaa2 (1ava A:1-346)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2416558Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2416559Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 2417027Protein Plant alpha-amylase [51474] (2 species)
  7. 2417038Species Barley (Hordeum vulgare), seeds, AMY2 isozyme [TaxId:4513] [51475] (3 PDB entries)
  8. 2417039Domain d1avaa2: 1ava A:1-346 [28784]
    Other proteins in same PDB: d1avaa1, d1avab1, d1avac_, d1avad_
    complexed with ca

Details for d1avaa2

PDB Entry: 1ava (more details), 1.9 Å

PDB Description: amy2/basi protein-protein complex from barley seed
PDB Compounds: (A:) barley alpha-amylase 2(cv menuet)

SCOPe Domain Sequences for d1avaa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1avaa2 c.1.8.1 (A:1-346) Plant alpha-amylase {Barley (Hordeum vulgare), seeds, AMY2 isozyme [TaxId: 4513]}
qvlfqgfnweswkhnggwynflmgkvddiaaagithvwlppasqsvaeqgympgrlydld
askygnkaqlksligalhgkgvkaiadivinhrtaehkdgrgiycifeggtpdarldwgp
hmicrddrpyadgtgnpdtgadfgaapdidhlnlrvqkelvewlnwlkadigfdgwrfdf
akgysadvakiyidrsepsfavaeiwtslayggdgkpnlnqdqhrqelvnwvdkvggkgp
attfdfttkgilnvavegelwrlrgtdgkapgmigwwpakavtfvdnhdtgstqhmwpfp
sdrvmqgyayilthpgtpcifydhffdwglkeeidrlvsvrtrhgi

SCOPe Domain Coordinates for d1avaa2:

Click to download the PDB-style file with coordinates for d1avaa2.
(The format of our PDB-style files is described here.)

Timeline for d1avaa2: