Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins) members of the family may contain various insert subdomains in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain |
Protein G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase) [51472] (1 species) |
Species Pseudomonas stutzeri [TaxId:316] [51473] (9 PDB entries) |
Domain d1qi5a2: 1qi5 A:1-357 [28779] Other proteins in same PDB: d1qi5a1 complexed with ca, mtt; mutant |
PDB Entry: 1qi5 (more details), 2 Å
SCOPe Domain Sequences for d1qi5a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qi5a2 c.1.8.1 (A:1-357) G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase) {Pseudomonas stutzeri [TaxId: 316]} dqagkspnavryhggdeiilqgfhwnvvreapndwynilrqqaatiaadgfsaiwmpvpw rdfsswsdgsksgggegyfwhdfnkngrygsdaqlrqaasalggagvkvlydvvpnhmnr gypdkeinlpagqgfwrndcadpgnypndcddgdrfiggdadlntghpqvygmfrdeftn lrsqygaggfrfdfvrgyapervnswmtdsadnsfcvgelwkgpseypnwdwrntaswqq iikdwsdrakcpvfdfalkermqngsiadwkhglngnpdprwrevavtfvdnhntgyspg qnggqhhwalqdglirqayayiltspgtpvvywdhmydwgygdfirqliqvrraagv
Timeline for d1qi5a2: