Lineage for d1jdda2 (1jdd A:1-357)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 682152Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) (S)
  5. 682153Family c.1.8.1: Amylase, catalytic domain [51446] (24 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 682451Protein G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase) [51472] (1 species)
  7. 682452Species Pseudomonas stutzeri [TaxId:316] [51473] (9 PDB entries)
  8. 682455Domain d1jdda2: 1jdd A:1-357 [28777]
    Other proteins in same PDB: d1jdda1
    complexed with ca, glc; mutant

Details for d1jdda2

PDB Entry: 1jdd (more details), 1.9 Å

PDB Description: mutant (e219q) maltotetraose-forming exo-amylase cocrystallized with maltotetraose (crystal type 2)
PDB Compounds: (A:) 1,4-alpha maltotetrahydrolase

SCOP Domain Sequences for d1jdda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jdda2 c.1.8.1 (A:1-357) G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase) {Pseudomonas stutzeri [TaxId: 316]}
dqagkspnavryhggdeiilqgfhwnvvreapndwynilrqqaatiaadgfsaiwmpvpw
rdfsswsdgsksgggegyfwhdfnkngrygsdaqlrqaasalggagvkvlydvvpnhmnr
gypdkeinlpagqgfwrndcadpgnypndcddgdrfiggdadlntghpqvygmfrdeftn
lrsqygaggfrfdfvrgyapervnswmtdsadnsfcvgqlwkgpseypnwdwrntaswqq
iikdwsdrakcpvfdfalkermqngsiadwkhglngnpdprwrevavtfvdnhdtgyspg
qnggqhhwalqdglirqayayiltspgtpvvywdhmydwgygdfirqliqvrraagv

SCOP Domain Coordinates for d1jdda2:

Click to download the PDB-style file with coordinates for d1jdda2.
(The format of our PDB-style files is described here.)

Timeline for d1jdda2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jdda1