Lineage for d1gcya2 (1gcy A:1-357)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2081497Family c.1.8.1: Amylase, catalytic domain [51446] (26 protein domains)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 2081808Protein G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase) [51472] (1 species)
  7. 2081809Species Pseudomonas stutzeri [TaxId:316] [51473] (9 PDB entries)
  8. 2081810Domain d1gcya2: 1gcy A:1-357 [28775]
    Other proteins in same PDB: d1gcya1
    complexed with ca

Details for d1gcya2

PDB Entry: 1gcy (more details), 1.6 Å

PDB Description: high resolution crystal structure of maltotetraose-forming exo-amylase
PDB Compounds: (A:) glucan 1,4-alpha-maltotetrahydrolase

SCOPe Domain Sequences for d1gcya2:

Sequence, based on SEQRES records: (download)

>d1gcya2 c.1.8.1 (A:1-357) G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase) {Pseudomonas stutzeri [TaxId: 316]}
dqagkspnavryhggdeiilqgfhwnvvreapndwynilrqqaatiaadgfsaiwmpvpw
rdfsswsdgsksgggegyfwhdfnkngrygsdaqlrqaasalggagvkvlydvvpnhmnr
gypdkeinlpagqgfwrndcadpgnypndcddgdrfiggdadlntghpqvygmfrdeftn
lrsqygaggfrfdfvrgyapervnswmtdsadnsfcvgelwkgpseypnwdwrntaswqq
iikdwsdrakcpvfdfalkermqngsiadwkhglngnpdprwrevavtfvdnhdtgyspg
qnggqhhwalqdglirqayayiltspgtpvvywdhmydwgygdfirqliqvrraagv

Sequence, based on observed residues (ATOM records): (download)

>d1gcya2 c.1.8.1 (A:1-357) G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase) {Pseudomonas stutzeri [TaxId: 316]}
dqagkspnavryhggdeiilqgfhwnvvreapndwynilrqqaatiaadgfsaiwmpvpw
rdfsswsksgggegyfwhdfnkngrygsdaqlrqaasalggagvkvlydvvpnhmnrgyp
dkeinlpagqgfwrndcadpgnypndcddgdrfiggdadlntghpqvygmfrdeftnlrs
qygaggfrfdfvrgyapervnswmtdsadnsfcvgelwkgpseypnwdwrntaswqqiik
dwsdrakcpvfdfalkermqngsiadwkhglngnpdprwrevavtfvdnhdtgyspgqng
gqhhwalqdglirqayayiltspgtpvvywdhmydwgygdfirqliqvrraagv

SCOPe Domain Coordinates for d1gcya2:

Click to download the PDB-style file with coordinates for d1gcya2.
(The format of our PDB-style files is described here.)

Timeline for d1gcya2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gcya1