Lineage for d1ehaa3 (1eha A:91-490)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 570217Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 571086Superfamily c.1.8: (Trans)glycosidases [51445] (13 families) (S)
  5. 571087Family c.1.8.1: Amylase, catalytic domain [51446] (24 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 571360Protein Glycosyltrehalose trehalohydrolase, central domain [51468] (1 species)
    contains an additional N-terminal domain
  7. 571361Species Archaeon Sulfolobus solfataricus, km1 [TaxId:2287] [51469] (2 PDB entries)
  8. 571363Domain d1ehaa3: 1eha A:91-490 [28773]
    Other proteins in same PDB: d1ehaa1, d1ehaa2
    mutant

Details for d1ehaa3

PDB Entry: 1eha (more details), 3 Å

PDB Description: crystal structure of glycosyltrehalose trehalohydrolase from sulfolobus solfataricus

SCOP Domain Sequences for d1ehaa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ehaa3 c.1.8.1 (A:91-490) Glycosyltrehalose trehalohydrolase, central domain {Archaeon Sulfolobus solfataricus, km1}
fnnetflkkedliiyeihvgtftpegtfegvirkldylkdlgitaieimpiaqfpgkrdw
gydgvylyavqnsyggpegfrklvdeahkkglgvildvvynhvgpegnymvklgpyfsqk
yktpwgltfnfddaesdevrkfilenveywikeynvdgfrldavhaiidtspkhileeia
dvvhkynriviaesdlndprvvnpkekvgynidaqwvddfhhsihayltgerqgyytdfg
nlddivksykdvfvydgkysnfrrkthgepvgeldgcnfvvyiqnhdqvgnrgkgeriik
lvdresykiaaalyllspyipmifmgeeygeenpfyffsdfsdskliqgvregrkkengq
dtdpqdestfnasklswkideeifsfykilikmrkelsia

SCOP Domain Coordinates for d1ehaa3:

Click to download the PDB-style file with coordinates for d1ehaa3.
(The format of our PDB-style files is described here.)

Timeline for d1ehaa3: