Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) |
Family c.1.8.1: Amylase, catalytic domain [51446] (22 proteins) members of the family may contain various insert subdomains in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain |
Protein Glycosyltrehalose trehalohydrolase, central domain [51468] (1 species) contains an additional N-terminal domain |
Species Archaeon Sulfolobus solfataricus, km1 [TaxId:2287] [51469] (2 PDB entries) |
Domain d1ehaa3: 1eha A:91-490 [28773] Other proteins in same PDB: d1ehaa1, d1ehaa2 mutant |
PDB Entry: 1eha (more details), 3 Å
SCOP Domain Sequences for d1ehaa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ehaa3 c.1.8.1 (A:91-490) Glycosyltrehalose trehalohydrolase, central domain {Archaeon Sulfolobus solfataricus, km1} fnnetflkkedliiyeihvgtftpegtfegvirkldylkdlgitaieimpiaqfpgkrdw gydgvylyavqnsyggpegfrklvdeahkkglgvildvvynhvgpegnymvklgpyfsqk yktpwgltfnfddaesdevrkfilenveywikeynvdgfrldavhaiidtspkhileeia dvvhkynriviaesdlndprvvnpkekvgynidaqwvddfhhsihayltgerqgyytdfg nlddivksykdvfvydgkysnfrrkthgepvgeldgcnfvvyiqnhdqvgnrgkgeriik lvdresykiaaalyllspyipmifmgeeygeenpfyffsdfsdskliqgvregrkkengq dtdpqdestfnasklswkideeifsfykilikmrkelsia
Timeline for d1ehaa3: