![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
![]() | Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins) members of the family may contain various insert subdomains in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain |
![]() | Protein Glycosyltrehalose trehalohydrolase, central domain [51468] (2 species) contains an additional N-terminal domain |
![]() | Species Sulfolobus solfataricus, km1 [TaxId:2287] [51469] (8 PDB entries) |
![]() | Domain d1eh9a3: 1eh9 A:91-490 [28772] Other proteins in same PDB: d1eh9a1, d1eh9a2 |
PDB Entry: 1eh9 (more details), 3 Å
SCOPe Domain Sequences for d1eh9a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eh9a3 c.1.8.1 (A:91-490) Glycosyltrehalose trehalohydrolase, central domain {Sulfolobus solfataricus, km1 [TaxId: 2287]} fnnetflkkedliiyeihvgtftpegtfegvirkldylkdlgitaieimpiaqfpgkrdw gydgvylyavqnsyggpegfrklvdeahkkglgvildvvynhvgpegnymvklgpyfsqk yktpwgltfnfddaesdevrkfilenveywikeynvdgfrldavhaiidtspkhileeia dvvhkynriviaesdlndprvvnpkekcgynidaqwvddfhhsihayltgerqgyytdfg nlddivksykdvfvydgkysnfrrkthgepvgeldgcnfvvyiqnhdqvgnrgkgeriik lvdresykiaaalyllspyipmifmgeeygeenpfyffsdfsdskliqgvregrkkengq dtdpqdestfnasklswkideeifsfykilikmrkelsia
Timeline for d1eh9a3: