Lineage for d1eh9a3 (1eh9 A:91-490)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2438500Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2438501Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 2438838Protein Glycosyltrehalose trehalohydrolase, central domain [51468] (2 species)
    contains an additional N-terminal domain
  7. 2438849Species Sulfolobus solfataricus, km1 [TaxId:2287] [51469] (8 PDB entries)
  8. 2438856Domain d1eh9a3: 1eh9 A:91-490 [28772]
    Other proteins in same PDB: d1eh9a1, d1eh9a2

Details for d1eh9a3

PDB Entry: 1eh9 (more details), 3 Å

PDB Description: crystal structure of sulfolobus solfataricus glycosyltrehalose trehalohydrolase
PDB Compounds: (A:) glycosyltrehalose trehalohydrolase

SCOPe Domain Sequences for d1eh9a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eh9a3 c.1.8.1 (A:91-490) Glycosyltrehalose trehalohydrolase, central domain {Sulfolobus solfataricus, km1 [TaxId: 2287]}
fnnetflkkedliiyeihvgtftpegtfegvirkldylkdlgitaieimpiaqfpgkrdw
gydgvylyavqnsyggpegfrklvdeahkkglgvildvvynhvgpegnymvklgpyfsqk
yktpwgltfnfddaesdevrkfilenveywikeynvdgfrldavhaiidtspkhileeia
dvvhkynriviaesdlndprvvnpkekcgynidaqwvddfhhsihayltgerqgyytdfg
nlddivksykdvfvydgkysnfrrkthgepvgeldgcnfvvyiqnhdqvgnrgkgeriik
lvdresykiaaalyllspyipmifmgeeygeenpfyffsdfsdskliqgvregrkkengq
dtdpqdestfnasklswkideeifsfykilikmrkelsia

SCOPe Domain Coordinates for d1eh9a3:

Click to download the PDB-style file with coordinates for d1eh9a3.
(The format of our PDB-style files is described here.)

Timeline for d1eh9a3: