Lineage for d1bvza3 (1bvz A:121-502)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 18710Superfamily c.1.8: (Trans)glycosidases [51445] (7 families) (S)
  5. 18711Family c.1.8.1: alpha-Amylases, N-terminal domain [51446] (11 proteins)
  6. 18818Protein Maltogenic amylase, central domain [51465] (2 species)
  7. 18819Species Thermoactinomyces vulgaris, TVAII [TaxId:2026] [51467] (1 PDB entry)
  8. 18820Domain d1bvza3: 1bvz A:121-502 [28770]
    Other proteins in same PDB: d1bvza1, d1bvza2, d1bvzb1, d1bvzb2

Details for d1bvza3

PDB Entry: 1bvz (more details), 2.6 Å

PDB Description: alpha-amylase ii (tvaii) from thermoactinomyces vulgaris r-47

SCOP Domain Sequences for d1bvza3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bvza3 c.1.8.1 (A:121-502) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAII}
vfttpewakeaviyqifperfangdpsndppgteqwakdarprhdsfyggdlkgvidrlp
yleelgvtalyftpifaspshhkydtadylaidpqfgdlptfrrlvdeahrrgikiilda
vfnhagdqffafrdvlqkgeqsrykdwffiedfpvsktsrtnyetfavqvpampklrten
pevkeylfdvarfwmeqgidgwrldvanevdhafwrefrrlvkslnpdalivgeiwhdas
gwlmgdqfdsvmnylfresvirffatgeihaerfdaeltrarmlypeqaaqglwnlldsh
dterfltscggneakfrlavlfqmtylgtpliyygdeigmagatdpdcrrpmiweekeqn
rglfefykelirlrhrlasltr

SCOP Domain Coordinates for d1bvza3:

Click to download the PDB-style file with coordinates for d1bvza3.
(The format of our PDB-style files is described here.)

Timeline for d1bvza3: