SCOPe 2.06: Domain d1smaa3: 1sma A:124-505

Lineage for d1smaa3 (1sma A:124-505)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
   members of the family may contain various insert subdomains
   in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain

6. Protein Maltogenic amylase, central domain [51465] (4 species)
   contains an additional N-terminal domain

7. Species Thermus sp. [TaxId:275] [51466] (2 PDB entries)

8. Domain d1smaa3: 1sma A:124-505 [28768]
   Other proteins in same PDB: d1smaa1, d1smaa2, d1smab1, d1smab2

Details for d1smaa3

PDB Entry: 1sma, 2.8 Å

PDB Description: crystal structure of a maltogenic amylase

PDB Compounds: (A:) maltogenic amylase

SCOPe Domain Sequences for d1smaa3:

Sequence; same for both SEQRES and ATOM records:

>d1smaa3 c.1.8.1 (A:124-505) Maltogenic amylase, central domain {Thermus sp. [TaxId: 275]}
dlfqapdwvkdtvwyqifperfangnpaispkgarpwgsedptptsffggdlqgiidhld
yladlgitgiyltpifrapsnhkydtadyfeidphfgdketlktlvkrchekgirvmlda
vfnhcgyefapfqdvlkngaasrykdwfhirefplqteprpnydtfafvphmpklntahp
evkrylldvatywirefdidgwrldvaneidhqfwrefrqavkalkpdvyilgeiwhdam
pwlrgdqfdavmnypladaalrffakedmsasefadrlmhvlhsypkqvneaafnllgsh
dtprlltvcggdvrkvkllflfqltftgspciyygdeigmtggndpecrkcmvwdpekqn
kelyehvkqlialrkqyralrr

Timeline for d1smaa3:

• d1smaa3 first appeared (with stable ids) in SCOP 1.55
  
• d1smaa3 appears in SCOPe 2.05
  
• d1smaa3 appears in SCOPe 2.07
  
• d1smaa3 appears in the current release, SCOPe 2.08