Lineage for d1smaa3 (1sma A:124-505)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 682152Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) (S)
  5. 682153Family c.1.8.1: Amylase, catalytic domain [51446] (24 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 682482Protein Maltogenic amylase, central domain [51465] (4 species)
    contains an additional N-terminal domain
  7. 682530Species Thermus sp. [TaxId:275] [51466] (2 PDB entries)
  8. 682533Domain d1smaa3: 1sma A:124-505 [28768]
    Other proteins in same PDB: d1smaa1, d1smaa2, d1smab1, d1smab2

Details for d1smaa3

PDB Entry: 1sma (more details), 2.8 Å

PDB Description: crystal structure of a maltogenic amylase
PDB Compounds: (A:) maltogenic amylase

SCOP Domain Sequences for d1smaa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1smaa3 c.1.8.1 (A:124-505) Maltogenic amylase, central domain {Thermus sp. [TaxId: 275]}
dlfqapdwvkdtvwyqifperfangnpaispkgarpwgsedptptsffggdlqgiidhld
yladlgitgiyltpifrapsnhkydtadyfeidphfgdketlktlvkrchekgirvmlda
vfnhcgyefapfqdvlkngaasrykdwfhirefplqteprpnydtfafvphmpklntahp
evkrylldvatywirefdidgwrldvaneidhqfwrefrqavkalkpdvyilgeiwhdam
pwlrgdqfdavmnypladaalrffakedmsasefadrlmhvlhsypkqvneaafnllgsh
dtprlltvcggdvrkvkllflfqltftgspciyygdeigmtggndpecrkcmvwdpekqn
kelyehvkqlialrkqyralrr

SCOP Domain Coordinates for d1smaa3:

Click to download the PDB-style file with coordinates for d1smaa3.
(The format of our PDB-style files is described here.)

Timeline for d1smaa3: