Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (13 families) |
Family c.1.8.1: Amylase, catalytic domain [51446] (24 proteins) members of the family may contain various insert subdomains in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain |
Protein Maltogenic amylase, central domain [51465] (4 species) contains an additional N-terminal domain |
Species Thermus sp. [TaxId:275] [51466] (2 PDB entries) |
Domain d1smaa3: 1sma A:124-505 [28768] Other proteins in same PDB: d1smaa1, d1smaa2, d1smab1, d1smab2 |
PDB Entry: 1sma (more details), 2.8 Å
SCOP Domain Sequences for d1smaa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1smaa3 c.1.8.1 (A:124-505) Maltogenic amylase, central domain {Thermus sp.} dlfqapdwvkdtvwyqifperfangnpaispkgarpwgsedptptsffggdlqgiidhld yladlgitgiyltpifrapsnhkydtadyfeidphfgdketlktlvkrchekgirvmlda vfnhcgyefapfqdvlkngaasrykdwfhirefplqteprpnydtfafvphmpklntahp evkrylldvatywirefdidgwrldvaneidhqfwrefrqavkalkpdvyilgeiwhdam pwlrgdqfdavmnypladaalrffakedmsasefadrlmhvlhsypkqvneaafnllgsh dtprlltvcggdvrkvkllflfqltftgspciyygdeigmtggndpecrkcmvwdpekqn kelyehvkqlialrkqyralrr
Timeline for d1smaa3: