Lineage for d2taaa2 (2taa A:1-381)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 18710Superfamily c.1.8: (Trans)glycosidases [51445] (7 families) (S)
  5. 18711Family c.1.8.1: alpha-Amylases, N-terminal domain [51446] (11 proteins)
  6. 18793Protein Fungal alpha-amylases [51462] (2 species)
  7. 18796Species Aspergillus oryzae, Taka-amylase [TaxId:5062] [51464] (3 PDB entries)
  8. 18799Domain d2taaa2: 2taa A:1-381 [28767]
    Other proteins in same PDB: d2taaa1

Details for d2taaa2

PDB Entry: 2taa (more details), 3 Å

PDB Description: structure and possible catalytic residues of taka-amylase a

SCOP Domain Sequences for d2taaa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2taaa2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus oryzae, Taka-amylase}
atpadwrsqsiyflltdrfartdgsttatcntadqkycggtwqgiidkldyiqgmgftai
witpvtaqlpqdcaygdaytgywqtdiyslnenygtaddlkalssalhergmylmvdvva
nhmgydgagssvdysvfkpfssqdyfhpfcfiqnyedqtqvedcwlgdntvslpdldttk
dvvknewydwvgslvsnysidglridtvkhvqkdfwpgynkaagvycigevldgdpaytc
pyqnvmdgvlnypiyypllnafkstsgsmddlynmintvksdcpdstllgtfvenhdnpr
fasytndialaknvaafiilndglpiiyagqeqhyaggndpanreatwlsgyptdselyk
liasanairnyaiskdtgfvt

SCOP Domain Coordinates for d2taaa2:

Click to download the PDB-style file with coordinates for d2taaa2.
(The format of our PDB-style files is described here.)

Timeline for d2taaa2: