Lineage for d7taa_2 (7taa 1-381)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 18710Superfamily c.1.8: (Trans)glycosidases [51445] (7 families) (S)
  5. 18711Family c.1.8.1: alpha-Amylases, N-terminal domain [51446] (11 proteins)
  6. 18793Protein Fungal alpha-amylases [51462] (2 species)
  7. 18796Species Aspergillus oryzae, Taka-amylase [TaxId:5062] [51464] (3 PDB entries)
  8. 18797Domain d7taa_2: 7taa 1-381 [28765]
    Other proteins in same PDB: d7taa_1

Details for d7taa_2

PDB Entry: 7taa (more details), 1.98 Å

PDB Description: family 13 alpha amylase in complex with acarbose

SCOP Domain Sequences for d7taa_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d7taa_2 c.1.8.1 (1-381) Fungal alpha-amylases {Aspergillus oryzae, Taka-amylase}
atpadwrsqsiyflltdrfartdgsttatcntadqkycggtwqgiidkldyiqgmgftai
witpvtaqlpqttaygdayhgywqqdiyslnenygtaddlkalssalhergmylmvdvva
nhmgydgagssvdysvfkpfssqdyfhpfcfiqnyedqtqvedcwlgdntvslpdldttk
dvvknewydwvgslvsnysidglridtvkhvqkdfwpgynkaagvycigevldgdpaytc
pyqnvmdgvlnypiyypllnafkstsgsmddlynmintvksdcpdstllgtfvenhdnpr
fasytndialaknvaafiilndgipiiyagqeqhyaggndpanreatwlsgyptdselyk
liasanairnyaiskdtgfvt

SCOP Domain Coordinates for d7taa_2:

Click to download the PDB-style file with coordinates for d7taa_2.
(The format of our PDB-style files is described here.)

Timeline for d7taa_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d7taa_1