Lineage for d2aaaa2 (2aaa A:1-381)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2438500Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2438501Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 2438812Protein Fungal alpha-amylases [51462] (2 species)
  7. 2438813Species Aspergillus niger, acid amylase [TaxId:5061] [51463] (1 PDB entry)
  8. 2438814Domain d2aaaa2: 2aaa A:1-381 [28764]
    Other proteins in same PDB: d2aaaa1
    complexed with ca

Details for d2aaaa2

PDB Entry: 2aaa (more details), 2.12 Å

PDB Description: calcium binding in alpha-amylases: an x-ray diffraction study at 2.1 angstroms resolution of two enzymes from aspergillus
PDB Compounds: (A:) alpha-amylase

SCOPe Domain Sequences for d2aaaa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aaaa2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus niger, acid amylase [TaxId: 5061]}
lsaaswrtqsiyflltdrfgrtdnsttatcntgneiycggswqgiidhldyiegmgftai
wispiteqlpqdtadgeayhgywqqkiydvnsnfgtadnlkslsdalhargmylmvdvvp
dhmgyagngndvdysvfdpfdsssyfhpyclitdwdnltmvedcwegdtivslpdldtte
tavrtiwydwvadlvsnysvdglridsvlevqpdffpgynkasgvycvgeidngnpasdc
pyqkvldgvlnypiywqllyafesssgsisnlynmiksvasdcsdptllgnfienhdnpr
fakytsdysqaknvlsyiflsdgipivyageeqhyaggkvpynreatwlsgydtsaelyt
wiattnairklaiaadsayit

SCOPe Domain Coordinates for d2aaaa2:

Click to download the PDB-style file with coordinates for d2aaaa2.
(The format of our PDB-style files is described here.)

Timeline for d2aaaa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2aaaa1