Lineage for d1tmqa2 (1tmq A:1-378)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 682152Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) (S)
  5. 682153Family c.1.8.1: Amylase, catalytic domain [51446] (24 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 682193Protein Animal alpha-amylase [51458] (3 species)
    contains Ca2+-binding subdomain, residues 100-170
  7. 682250Species Yellow mealworm (Tenebrio molitor), larva [TaxId:7067] [51461] (4 PDB entries)
  8. 682253Domain d1tmqa2: 1tmq A:1-378 [28762]
    Other proteins in same PDB: d1tmqa1, d1tmqb_
    complexed with ca, cl

Details for d1tmqa2

PDB Entry: 1tmq (more details), 2.5 Å

PDB Description: structure of tenebrio molitor larval alpha-amylase in complex with ragi bifunctional inhibitor
PDB Compounds: (A:) protein (alpha-amylase)

SCOP Domain Sequences for d1tmqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tmqa2 c.1.8.1 (A:1-378) Animal alpha-amylase {Yellow mealworm (Tenebrio molitor), larva [TaxId: 7067]}
ekdanfasgrnsivhlfewkwndiadecerflqpqgfggvqisppneylvadgrpwwery
qpvsyiintrsgdesaftdmtrrcndagvriyvdavinhmtgmngvgtsgssadhdgmny
pavpygsgdfhspcevnnyqdadnvrncelvglrdlnqgsdyvrgvlidymnhmidlgva
gfrvdaakhmspgdlsvifsglknlntdygfadgarpfiyqevidlggeaiskneytgfg
cvlefqfgvslgnafqggnqlknlanwgpewgllegldavvfvdnhdnqrtggsqiltyk
npkpykmaiafmlahpygttrimssfdftdndqgppqdgsgnlispginddntcsngyvc
ehrwrqvygmvgfrnave

SCOP Domain Coordinates for d1tmqa2:

Click to download the PDB-style file with coordinates for d1tmqa2.
(The format of our PDB-style files is described here.)

Timeline for d1tmqa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tmqa1
View in 3D
Domains from other chains:
(mouse over for more information)
d1tmqb_