Lineage for d1tmqa2 (1tmq A:1-378)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 64292Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 64720Superfamily c.1.8: (Trans)glycosidases [51445] (8 families) (S)
  5. 64721Family c.1.8.1: alpha-Amylases, N-terminal domain [51446] (12 proteins)
  6. 64726Protein Animal alpha-amylase [51458] (3 species)
  7. 64747Species Yellow mealworm (Tenebrio molitor), larva [TaxId:7067] [51461] (4 PDB entries)
  8. 64750Domain d1tmqa2: 1tmq A:1-378 [28762]
    Other proteins in same PDB: d1tmqa1, d1tmqb_

Details for d1tmqa2

PDB Entry: 1tmq (more details), 2.5 Å

PDB Description: structure of tenebrio molitor larval alpha-amylase in complex with ragi bifunctional inhibitor

SCOP Domain Sequences for d1tmqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tmqa2 c.1.8.1 (A:1-378) Animal alpha-amylase {Yellow mealworm (Tenebrio molitor), larva}
ekdanfasgrnsivhlfewkwndiadecerflqpqgfggvqisppneylvadgrpwwery
qpvsyiintrsgdesaftdmtrrcndagvriyvdavinhmtgmngvgtsgssadhdgmny
pavpygsgdfhspcevnnyqdadnvrncelvglrdlnqgsdyvrgvlidymnhmidlgva
gfrvdaakhmspgdlsvifsglknlntdygfadgarpfiyqevidlggeaiskneytgfg
cvlefqfgvslgnafqggnqlknlanwgpewgllegldavvfvdnhdnqrtggsqiltyk
npkpykmaiafmlahpygttrimssfdftdndqgppqdgsgnlispginddntcsngyvc
ehrwrqvygmvgfrnave

SCOP Domain Coordinates for d1tmqa2:

Click to download the PDB-style file with coordinates for d1tmqa2.
(The format of our PDB-style files is described here.)

Timeline for d1tmqa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tmqa1
View in 3D
Domains from other chains:
(mouse over for more information)
d1tmqb_