SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2hldt1 (2hld T:26-96)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2058388Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
    barrel, closed; n=6, S=8; greek-key
  4. 2058389Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families) (S)
    automatically mapped to Pfam PF02874
  5. 2058390Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 protein domains)
    6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?)
  6. 2058391Protein F1 ATP synthase alpha subunit, domain 1 [88672] (5 species)
  7. 2058394Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [310923] (2 PDB entries)
  8. 2058408Domain d2hldt1: 2hld T:26-96 [287613]
    Other proteins in same PDB: d2hld1_, d2hlda2, d2hlda3, d2hldb2, d2hldb3, d2hldc2, d2hldc3, d2hldd1, d2hldd2, d2hldd3, d2hlde1, d2hlde2, d2hlde3, d2hldf1, d2hldf2, d2hldf3, d2hldg_, d2hldh1, d2hldh2, d2hldi_, d2hldj2, d2hldj3, d2hldk2, d2hldk3, d2hldl2, d2hldl3, d2hldm1, d2hldm2, d2hldm3, d2hldn1, d2hldn2, d2hldn3, d2hldo1, d2hldo2, d2hldo3, d2hldp_, d2hldq1, d2hldq2, d2hldr_, d2hlds2, d2hlds3, d2hldt2, d2hldt3, d2hldu2, d2hldu3, d2hldv1, d2hldv2, d2hldv3, d2hldw1, d2hldw2, d2hldw3, d2hldx1, d2hldx2, d2hldx3, d2hldy_, d2hldz1
    complexed with anp, mg, po4

Details for d2hldt1

PDB Entry: 2hld (more details), 2.8 Å

PDB Description: Crystal structure of yeast mitochondrial F1-ATPase
PDB Compounds: (T:) ATP synthase alpha chain, mitochondrial

SCOPe Domain Sequences for d2hldt1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hldt1 b.49.1.1 (T:26-96) F1 ATP synthase alpha subunit, domain 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
nlnetgrvlavgdgiarvfglnniqaeelvefssgvkgmalnlepgqvgivlfgsdrlvk
egelvkrtgni

SCOPe Domain Coordinates for d2hldt1:

Click to download the PDB-style file with coordinates for d2hldt1.
(The format of our PDB-style files is described here.)

Timeline for d2hldt1:

  • d2hldt1 is new in SCOPe 2.06-stable

View in 3D
Domains from other chains:
(mouse over for more information)
d2hld1_, d2hlda1, d2hlda2, d2hlda3, d2hldb1, d2hldb2, d2hldb3, d2hldc1, d2hldc2, d2hldc3, d2hldd1, d2hldd2, d2hldd3, d2hlde1, d2hlde2, d2hlde3, d2hldf1, d2hldf2, d2hldf3, d2hldg_, d2hldh1, d2hldh2, d2hldi_, d2hldj1, d2hldj2, d2hldj3, d2hldk1, d2hldk2, d2hldk3, d2hldl1, d2hldl2, d2hldl3, d2hldm1, d2hldm2, d2hldm3, d2hldn1, d2hldn2, d2hldn3, d2hldo1, d2hldo2, d2hldo3, d2hldp_, d2hldq1, d2hldq2, d2hldr_, d2hlds1, d2hlds2, d2hlds3, d2hldu1, d2hldu2, d2hldu3, d2hldv1, d2hldv2, d2hldv3, d2hldw1, d2hldw2, d2hldw3, d2hldx1, d2hldx2, d2hldx3, d2hldy_, d2hldz1