Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) |
Family c.1.8.1: Amylase, catalytic domain [51446] (25 proteins) members of the family may contain various insert subdomains in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain |
Protein Animal alpha-amylase [51458] (3 species) contains Ca2+-binding subdomain, residues 100-170 |
Species Yellow mealworm (Tenebrio molitor), larva [TaxId:7067] [51461] (4 PDB entries) |
Domain d1clva2: 1clv A:1-378 [28761] Other proteins in same PDB: d1clva1, d1clvi_ complexed with ca, cl |
PDB Entry: 1clv (more details), 2 Å
SCOP Domain Sequences for d1clva2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1clva2 c.1.8.1 (A:1-378) Animal alpha-amylase {Yellow mealworm (Tenebrio molitor), larva [TaxId: 7067]} ekdanfasgrnsivhlfewkwndiadecerflqpqgfggvqisppneylvadgrpwwery qpvsyiintrsgdesaftdmtrrcndagvriyvdavinhmtgmngvgtsgssadhdgmny pavpygsgdfhspcevnnyqdadnvrncelvglrdlnqgsdyvrgvlidymnhmidlgva gfrvdaakhmspgdlsvifsglknlntdygfadgarpfiyqevidlggeaiskneytgfg cvlefqfgvslgnafqggnqlknlanwgpewgllegldavvfvdnhdnqrtggsqiltyk npkpykmaiafmlahpygttrimssfdftdndqgppqdgsgnlispginddntcsngyvc ehrwrqvygmvgfrnave
Timeline for d1clva2: