Lineage for d2hldq1 (2hld Q:12-90)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2819404Fold b.93: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51343] (1 superfamily)
    pseudobarrel: sandwich of two sheets packed at a positive interstrand angle and interconnected with many short turns
  4. 2819405Superfamily b.93.1: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51344] (1 family) (S)
  5. 2819406Family b.93.1.1: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51345] (2 proteins)
  6. 2819407Protein Epsilon subunit of F1F0-ATP synthase N-terminal domain [51346] (3 species)
    delta subunit in mitochondria
  7. 2819408Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [310954] (5 PDB entries)
  8. 2819410Domain d2hldq1: 2hld Q:12-90 [287607]
    Other proteins in same PDB: d2hld1_, d2hlda1, d2hlda2, d2hlda3, d2hldb1, d2hldb2, d2hldb3, d2hldc1, d2hldc2, d2hldc3, d2hldd1, d2hldd2, d2hldd3, d2hlde1, d2hlde2, d2hlde3, d2hldf1, d2hldf2, d2hldf3, d2hldg_, d2hldh2, d2hldi_, d2hldj1, d2hldj2, d2hldj3, d2hldk1, d2hldk2, d2hldk3, d2hldl1, d2hldl2, d2hldl3, d2hldm1, d2hldm2, d2hldm3, d2hldn1, d2hldn2, d2hldn3, d2hldo1, d2hldo2, d2hldo3, d2hldp_, d2hldq2, d2hldr_, d2hlds1, d2hlds2, d2hlds3, d2hldt1, d2hldt2, d2hldt3, d2hldu1, d2hldu2, d2hldu3, d2hldv1, d2hldv2, d2hldv3, d2hldw1, d2hldw2, d2hldw3, d2hldx1, d2hldx2, d2hldx3, d2hldy_, d2hldz1
    complexed with anp, mg, po4

Details for d2hldq1

PDB Entry: 2hld (more details), 2.8 Å

PDB Description: Crystal structure of yeast mitochondrial F1-ATPase
PDB Compounds: (Q:) ATP synthase delta chain, mitochondrial

SCOPe Domain Sequences for d2hldq1:

Sequence, based on SEQRES records: (download)

>d2hldq1 b.93.1.1 (Q:12-90) Epsilon subunit of F1F0-ATP synthase N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lqfalphetlysgsevtqvnlpaksgrigvlanhvptveqllpgvvevmegsnskkffis
ggfatvqpdsqlcvtaiea

Sequence, based on observed residues (ATOM records): (download)

>d2hldq1 b.93.1.1 (Q:12-90) Epsilon subunit of F1F0-ATP synthase N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lqfalpheqvnlpaksgrigvlanhvptveqllpgvvfisggfatvqpdsqlcvtaiea

SCOPe Domain Coordinates for d2hldq1:

Click to download the PDB-style file with coordinates for d2hldq1.
(The format of our PDB-style files is described here.)

Timeline for d2hldq1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hldq2
View in 3D
Domains from other chains:
(mouse over for more information)
d2hld1_, d2hlda1, d2hlda2, d2hlda3, d2hldb1, d2hldb2, d2hldb3, d2hldc1, d2hldc2, d2hldc3, d2hldd1, d2hldd2, d2hldd3, d2hlde1, d2hlde2, d2hlde3, d2hldf1, d2hldf2, d2hldf3, d2hldg_, d2hldh1, d2hldh2, d2hldi_, d2hldj1, d2hldj2, d2hldj3, d2hldk1, d2hldk2, d2hldk3, d2hldl1, d2hldl2, d2hldl3, d2hldm1, d2hldm2, d2hldm3, d2hldn1, d2hldn2, d2hldn3, d2hldo1, d2hldo2, d2hldo3, d2hldp_, d2hldr_, d2hlds1, d2hlds2, d2hlds3, d2hldt1, d2hldt2, d2hldt3, d2hldu1, d2hldu2, d2hldu3, d2hldv1, d2hldv2, d2hldv3, d2hldw1, d2hldw2, d2hldw3, d2hldx1, d2hldx2, d2hldx3, d2hldy_, d2hldz1