Lineage for d1jae_2 (1jae 1-378)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies) Superfamily c.1.8: (Trans)glycosidases [51445] (7 families) 
Family c.1.8.1: alpha-Amylases, N-terminal domain [51446] (11 proteins) 
Protein Animal alpha-amylase [51458] (3 species) Species Yellow mealworm (Tenebrio molitor), larva [TaxId:7067] [51461] (4 PDB entries) 
Domain d1jae_2: 1jae 1-378 [28760]
Other proteins in same PDB: d1jae_1
Details for d1jae_2
PDB Entry: 1jae (more details), 1.65 Å
PDB Description: structure of tenebrio molitor larval alpha-amylase
SCOP Domain Sequences for d1jae_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jae_2 c.1.8.1 (1-378) Animal alpha-amylase {Yellow mealworm (Tenebrio molitor), larva}
ekdanfasgrnsivhlfewkwndiadecerflqpqgfggvqisppneylvadgrpwwery
qpvsyiintrsgdesaftdmtrrcndagvriyvdavinhmtgmngvgtsgssadhdgmny
pavpygsgdfhspcevnnyqdadnvrncelvglrdlnqgsdyvrgvlidymnhmidlgva
gfrvdaakhmspgdlsvifsglknlntdygfadgarpfiyqevidlggeaiskneytgfg
cvlefqfgvslgnafqggnqlknlanwgpewgllegldavvfvdnhdnqrtggsqiltyk
npkpykmaiafmlahpygttrimssfdftdndqgppqdgsgnlispginddntcsngyvc
ehrwrqvygmvgfrnave
SCOP Domain Coordinates for d1jae_2:
Click to download the PDB-style file with coordinates for d1jae_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jae_2:
- d1jae_2 appears in SCOP 1.57
- d1jae_2 appears in the current release, SCOPe 2.08, called d1jaea2
View in 3D
