Lineage for d1jae_2 (1jae 1-378)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 18710Superfamily c.1.8: (Trans)glycosidases [51445] (7 families) (S)
  5. 18711Family c.1.8.1: alpha-Amylases, N-terminal domain [51446] (11 proteins)
  6. 18715Protein Animal alpha-amylase [51458] (3 species)
  7. 18730Species Yellow mealworm (Tenebrio molitor), larva [TaxId:7067] [51461] (4 PDB entries)
  8. 18731Domain d1jae_2: 1jae 1-378 [28760]
    Other proteins in same PDB: d1jae_1

Details for d1jae_2

PDB Entry: 1jae (more details), 1.65 Å

PDB Description: structure of tenebrio molitor larval alpha-amylase
PDB Compounds: ( :)

SCOP Domain Sequences for d1jae_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jae_2 c.1.8.1 (1-378) Animal alpha-amylase {Yellow mealworm (Tenebrio molitor), larva}
ekdanfasgrnsivhlfewkwndiadecerflqpqgfggvqisppneylvadgrpwwery
qpvsyiintrsgdesaftdmtrrcndagvriyvdavinhmtgmngvgtsgssadhdgmny
pavpygsgdfhspcevnnyqdadnvrncelvglrdlnqgsdyvrgvlidymnhmidlgva
gfrvdaakhmspgdlsvifsglknlntdygfadgarpfiyqevidlggeaiskneytgfg
cvlefqfgvslgnafqggnqlknlanwgpewgllegldavvfvdnhdnqrtggsqiltyk
npkpykmaiafmlahpygttrimssfdftdndqgppqdgsgnlispginddntcsngyvc
ehrwrqvygmvgfrnave

SCOP Domain Coordinates for d1jae_2:

Click to download the PDB-style file with coordinates for d1jae_2.
(The format of our PDB-style files is described here.)

Timeline for d1jae_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jae_1