SCOPe 2.06: Domain d2hldi_: 2hld I:

Lineage for d2hldi_ (2hld I:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
   not a true fold

4. Superfamily a.137.8: Epsilon subunit of mitochondrial F1F0-ATP synthase [48690] (1 family)
   automatically mapped to Pfam PF04627

5. Family a.137.8.1: Epsilon subunit of mitochondrial F1F0-ATP synthase [48691] (2 proteins)

6. Protein Epsilon subunit of mitochondrial F1F0-ATP synthase [48692] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [310956] (5 PDB entries)

8. Domain d2hldi_: 2hld I: [287597]
   Other proteins in same PDB: d2hlda1, d2hlda2, d2hlda3, d2hldb1, d2hldb2, d2hldb3, d2hldc1, d2hldc2, d2hldc3, d2hldd1, d2hldd2, d2hldd3, d2hlde1, d2hlde2, d2hlde3, d2hldf1, d2hldf2, d2hldf3, d2hldg_, d2hldh1, d2hldh2, d2hldj1, d2hldj2, d2hldj3, d2hldk1, d2hldk2, d2hldk3, d2hldl1, d2hldl2, d2hldl3, d2hldm1, d2hldm2, d2hldm3, d2hldn1, d2hldn2, d2hldn3, d2hldo1, d2hldo2, d2hldo3, d2hldp_, d2hldq1, d2hldq2, d2hlds1, d2hlds2, d2hlds3, d2hldt1, d2hldt2, d2hldt3, d2hldu1, d2hldu2, d2hldu3, d2hldv1, d2hldv2, d2hldv3, d2hldw1, d2hldw2, d2hldw3, d2hldx1, d2hldx2, d2hldx3, d2hldy_, d2hldz1
   complexed with anp, mg, po4

Details for d2hldi_

PDB Entry: 2hld, 2.8 Å

PDB Description: Crystal structure of yeast mitochondrial F1-ATPase

PDB Compounds: (I:) ATP synthase epsilon chain, mitochondrial

SCOPe Domain Sequences for d2hldi_:

Sequence, based on SEQRES records:

>d2hldi_ a.137.8.1 (I:) Epsilon subunit of mitochondrial F1F0-ATP synthase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
isyaaylnvaaqairsslktelqtasvlnrsqtdafytqykngtaaseptpitk

Sequence, based on observed residues (ATOM records):

>d2hldi_ a.137.8.1 (I:) Epsilon subunit of mitochondrial F1F0-ATP synthase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
isyaaylnvaaqairstelqtasvlnrsqtdafytqyknaseptpitk

Timeline for d2hldi_:

• d2hldi_ is new in SCOPe 2.06-stable
  
• d2hldi_ appears in SCOPe 2.07
  
• d2hldi_ appears in the current release, SCOPe 2.08