Lineage for d1b2ya2 (1b2y A:2-403)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 18710Superfamily c.1.8: (Trans)glycosidases [51445] (7 families) (S)
  5. 18711Family c.1.8.1: alpha-Amylases, N-terminal domain [51446] (11 proteins)
  6. 18715Protein Animal alpha-amylase [51458] (3 species)
  7. 18716Species Human (Homo sapiens) [TaxId:9606] [51460] (5 PDB entries)
  8. 18721Domain d1b2ya2: 1b2y A:2-403 [28759]
    Other proteins in same PDB: d1b2ya1

Details for d1b2ya2

PDB Entry: 1b2y (more details), 3.2 Å

PDB Description: structure of human pancreatic alpha-amylase in complex with the carbohydrate inhibitor acarbose

SCOP Domain Sequences for d1b2ya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b2ya2 c.1.8.1 (A:2-403) Animal alpha-amylase {Human (Homo sapiens)}
yspntqqgrtsivhlfewrwvdialecerylapkgfggvqvsppnenvaiynpfrpwwer
yqpvsyklctrsgnedefrnmvtrcnnvgvriyvdavinhmcgnavsagtsstcgsyfnp
gsrdfpavpysgwdfndgkcktgsgdienyndatqvrdcrltglldlalekdyvrskiae
ymnhlidigvagfrldaskhmwpgdikaildklhnlnsnwfpagskpfiyqevidlggep
ikssdyfgngrvtefkygaklgtvirkwngekmsylknwgegwgfvpsdralvfvdnhdn
qrghgaggasiltfwdarlykmavgfmlahpygftrvmssyrwprqfqngndvndwvgpp
nnngvikevtinpdttcgndwvcehrwrqirnmvifrnvvdg

SCOP Domain Coordinates for d1b2ya2:

Click to download the PDB-style file with coordinates for d1b2ya2.
(The format of our PDB-style files is described here.)

Timeline for d1b2ya2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1b2ya1