SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1b2ya2 (1b2y A:2-403)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2081497Family c.1.8.1: Amylase, catalytic domain [51446] (26 protein domains)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 2081537Protein Animal alpha-amylase [51458] (3 species)
    contains Ca2+-binding subdomain, residues 100-170
  7. 2081538Species Human (Homo sapiens) [TaxId:9606] [51460] (52 PDB entries)
    Uniprot P04746 16-511 ! SQ 04746
  8. 2081587Domain d1b2ya2: 1b2y A:2-403 [28759]
    Other proteins in same PDB: d1b2ya1
    complexed with ca, cl, pca

Details for d1b2ya2

PDB Entry: 1b2y (more details), 3.2 Å

PDB Description: structure of human pancreatic alpha-amylase in complex with the carbohydrate inhibitor acarbose
PDB Compounds: (A:) protein (alpha-amylase)

SCOPe Domain Sequences for d1b2ya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b2ya2 c.1.8.1 (A:2-403) Animal alpha-amylase {Human (Homo sapiens) [TaxId: 9606]}
yspntqqgrtsivhlfewrwvdialecerylapkgfggvqvsppnenvaiynpfrpwwer
yqpvsyklctrsgnedefrnmvtrcnnvgvriyvdavinhmcgnavsagtsstcgsyfnp
gsrdfpavpysgwdfndgkcktgsgdienyndatqvrdcrltglldlalekdyvrskiae
ymnhlidigvagfrldaskhmwpgdikaildklhnlnsnwfpagskpfiyqevidlggep
ikssdyfgngrvtefkygaklgtvirkwngekmsylknwgegwgfvpsdralvfvdnhdn
qrghgaggasiltfwdarlykmavgfmlahpygftrvmssyrwprqfqngndvndwvgpp
nnngvikevtinpdttcgndwvcehrwrqirnmvifrnvvdg

SCOPe Domain Coordinates for d1b2ya2:

Click to download the PDB-style file with coordinates for d1b2ya2.
(The format of our PDB-style files is described here.)

Timeline for d1b2ya2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1b2ya1