Lineage for d2hlda1 (2hld A:26-96)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2058388Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
    barrel, closed; n=6, S=8; greek-key
  4. 2058389Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families) (S)
    automatically mapped to Pfam PF02874
  5. 2058390Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 protein domains)
    6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?)
  6. 2058391Protein F1 ATP synthase alpha subunit, domain 1 [88672] (5 species)
  7. 2058394Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [310923] (2 PDB entries)
  8. 2058401Domain d2hlda1: 2hld A:26-96 [287586]
    Other proteins in same PDB: d2hld1_, d2hlda2, d2hlda3, d2hldb2, d2hldb3, d2hldc2, d2hldc3, d2hldd1, d2hldd2, d2hldd3, d2hlde1, d2hlde2, d2hlde3, d2hldf1, d2hldf2, d2hldf3, d2hldg_, d2hldh1, d2hldh2, d2hldi_, d2hldj2, d2hldj3, d2hldk2, d2hldk3, d2hldl2, d2hldl3, d2hldm1, d2hldm2, d2hldm3, d2hldn1, d2hldn2, d2hldn3, d2hldo1, d2hldo2, d2hldo3, d2hldp_, d2hldq1, d2hldq2, d2hldr_, d2hlds2, d2hlds3, d2hldt2, d2hldt3, d2hldu2, d2hldu3, d2hldv1, d2hldv2, d2hldv3, d2hldw1, d2hldw2, d2hldw3, d2hldx1, d2hldx2, d2hldx3, d2hldy_, d2hldz1
    complexed with anp, mg, po4

Details for d2hlda1

PDB Entry: 2hld (more details), 2.8 Å

PDB Description: Crystal structure of yeast mitochondrial F1-ATPase
PDB Compounds: (A:) ATP synthase alpha chain, mitochondrial

SCOPe Domain Sequences for d2hlda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hlda1 b.49.1.1 (A:26-96) F1 ATP synthase alpha subunit, domain 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
nlnetgrvlavgdgiarvfglnniqaeelvefssgvkgmalnlepgqvgivlfgsdrlvk
egelvkrtgni

SCOPe Domain Coordinates for d2hlda1:

Click to download the PDB-style file with coordinates for d2hlda1.
(The format of our PDB-style files is described here.)

Timeline for d2hlda1:

  • d2hlda1 is new in SCOPe 2.06-stable

View in 3D
Domains from other chains:
(mouse over for more information)
d2hld1_, d2hldb1, d2hldb2, d2hldb3, d2hldc1, d2hldc2, d2hldc3, d2hldd1, d2hldd2, d2hldd3, d2hlde1, d2hlde2, d2hlde3, d2hldf1, d2hldf2, d2hldf3, d2hldg_, d2hldh1, d2hldh2, d2hldi_, d2hldj1, d2hldj2, d2hldj3, d2hldk1, d2hldk2, d2hldk3, d2hldl1, d2hldl2, d2hldl3, d2hldm1, d2hldm2, d2hldm3, d2hldn1, d2hldn2, d2hldn3, d2hldo1, d2hldo2, d2hldo3, d2hldp_, d2hldq1, d2hldq2, d2hldr_, d2hlds1, d2hlds2, d2hlds3, d2hldt1, d2hldt2, d2hldt3, d2hldu1, d2hldu2, d2hldu3, d2hldv1, d2hldv2, d2hldv3, d2hldw1, d2hldw2, d2hldw3, d2hldx1, d2hldx2, d2hldx3, d2hldy_, d2hldz1