Lineage for d1cpua2 (1cpu A:1-403)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2829819Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 2829862Protein Animal alpha-amylase [51458] (3 species)
    contains Ca2+-binding subdomain, residues 100-170
  7. 2829863Species Human (Homo sapiens) [TaxId:9606] [51460] (55 PDB entries)
    Uniprot P04746 16-511 ! SQ 04746
  8. 2829898Domain d1cpua2: 1cpu A:1-403 [28758]
    Other proteins in same PDB: d1cpua1
    complexed with ca, cl, hmc, nag
    has additional subdomain(s) that are not in the common domain

Details for d1cpua2

PDB Entry: 1cpu (more details), 2 Å

PDB Description: subsite mapping of the active site of human pancreatic alpha-amylase using substrates, the pharmacological inhibitor acarbose, and an active site variant
PDB Compounds: (A:) protein (alpha-amylase)

SCOPe Domain Sequences for d1cpua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cpua2 c.1.8.1 (A:1-403) Animal alpha-amylase {Human (Homo sapiens) [TaxId: 9606]}
eyspntqqgrtsivhlfewrwvdialecerylapkgfggvqvsppnenvaiynpfrpwwe
ryqpvsyklctrsgnedefrnmvtrcnnvgvriyvdavinhmcgnavsagtsstcgsyfn
pgsrdfpavpysgwdfndgkcktgsgdienyndatqvrdcrltglldlalekdyvrskia
eymnhlidigvagfrldaskhmwpgdikaildklhnlnsnwfpagskpfiyqevidlgge
pikssdyfgngrvtefkygaklgtvirkwngekmsylknwgegwgfvpsdralvfvdnhd
nqrghgaggasiltfwdarlykmavgfmlahpygftrvmssyrwprqfqngndvndwvgp
pnnngvikevtinpdttcgndwvcehrwrqirnmvifrnvvdg

SCOPe Domain Coordinates for d1cpua2:

Click to download the PDB-style file with coordinates for d1cpua2.
(The format of our PDB-style files is described here.)

Timeline for d1cpua2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1cpua1