SCOP 1.63: Domain d1pig_2: 1pig 1-403

Lineage for d1pig_2 (1pig 1-403)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (9 families)

5. Family c.1.8.1: Amylase, catalytic domain [51446] (21 proteins)
   members of the family may contain various insert subdomains
   in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain

6. Protein Animal alpha-amylase [51458] (3 species)
   contains Ca2+-binding subdomain, residues 100-170

7. Species Pig (Sus scrofa) [TaxId:9823] [51459] (11 PDB entries)

8. Domain d1pig_2: 1pig 1-403 [28751]
   Other proteins in same PDB: d1pig_1
   complexed with agl, ca, cl, glc, hmc

Details for d1pig_2

PDB Entry: 1pig, 2.2 Å

PDB Description: pig pancreatic alpha-amylase complexed with the oligosaccharide v-1532

SCOP Domain Sequences for d1pig_2:

Sequence; same for both SEQRES and ATOM records:

>d1pig_2 c.1.8.1 (1-403) Animal alpha-amylase {Pig (Sus scrofa)}
eyapqtqsgrtsivhlfewrwvdialecerylgpkgfggvqvsppnenvvvtnpsrpwwe
ryqpvsyklctrsgnenefrdmvtrcnnvgvriyvdavinhmcgsgaaagtgttcgsycn
pgsrefpavpysawdfndgkcktasggiesyndpyqvrdcqlvglldlalekdyvrsmia
dylnklidigvagfridaskhmwpgdikavldklhnlntnwfpagsrpfifqevidlgge
aissseyfgngrvtefkygaklgtvvrkwsgekmsylknwgegwgfmpsdralvfvdnhd
nqrghgaggssiltfwdarlykvavgfmlahpygftrvmssyrwarnfvngedvndwigp
pnnngvikevtinadttcgndwvcehrwreirnmvwfrnvvdg

Timeline for d1pig_2:

• d1pig_2 first appeared (with stable ids) in SCOP 1.55
  
• d1pig_2 appears in SCOP 1.61
  
• d1pig_2 appears in SCOP 1.65
  
• d1pig_2 appears in the current release, SCOPe 2.08, called d1piga2