Lineage for d1dhka2 (1dhk A:1-403)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2829819Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 2829862Protein Animal alpha-amylase [51458] (3 species)
    contains Ca2+-binding subdomain, residues 100-170
  7. 2829919Species Pig (Sus scrofa) [TaxId:9823] [51459] (13 PDB entries)
  8. 2829927Domain d1dhka2: 1dhk A:1-403 [28748]
    Other proteins in same PDB: d1dhka1, d1dhkb_
    complexed with ca, cl, nag
    has additional subdomain(s) that are not in the common domain

Details for d1dhka2

PDB Entry: 1dhk (more details), 1.85 Å

PDB Description: structure of porcine pancreatic alpha-amylase
PDB Compounds: (A:) porcine pancreatic alpha-amylase

SCOPe Domain Sequences for d1dhka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dhka2 c.1.8.1 (A:1-403) Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 9823]}
eyapqtqsgrtsivhlfewrwvdialecerylgpkgfggvqvsppnenvvvtnpsrpwwe
ryqpvsyklctrsgnenefrdmvtrcnnvgvriyvdavinhmcgsgaaagtgttcgsycn
pgsrefpavpysawdfndgkcktasggiesyndpyqvrdcqlvglldlalekdyvrsmia
dylnklidigvagfridaskhmwpgdikavldklhnlntnwfpagsrpfifqevidlgge
aiqsseyfgngrvtefkygaklgtvvrkwsgekmsylknwgegwgfmpsdralvfvdnhd
nqrghgaggasiltfwdarlykvavgfmlahpygftrvmssyrwarnfvngedvndwigp
pnnngvikevtinadttcgndwvcehrwreirnmvwfrnvvdg

SCOPe Domain Coordinates for d1dhka2:

Click to download the PDB-style file with coordinates for d1dhka2.
(The format of our PDB-style files is described here.)

Timeline for d1dhka2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dhka1
View in 3D
Domains from other chains:
(mouse over for more information)
d1dhkb_