SCOP 1.65: Domain d1a47_4: 1a47 1-406

Lineage for d1a47_4 (1a47 1-406)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (9 families)

5. Family c.1.8.1: Amylase, catalytic domain [51446] (22 proteins)
   members of the family may contain various insert subdomains
   in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain

6. Protein Cyclodextrin glycosyltransferase [51452] (5 species)
   contains two more all-beta domains, one is Immunoglobulin-like and the other is trasthyretin-like

7. Species Thermoanaerobacterium thermosulfurigenes, EM1 [TaxId:33950] [51457] (2 PDB entries)

8. Domain d1a47_4: 1a47 1-406 [28747]
   Other proteins in same PDB: d1a47_1, d1a47_2, d1a47_3
   complexed with ca, cyl, glc, gld, gte

Details for d1a47_4

PDB Entry: 1a47, 2.56 Å

PDB Description: cgtase from thermoanaerobacterium thermosulfurigenes em1 in complex with a maltohexaose inhibitor

SCOP Domain Sequences for d1a47_4:

Sequence; same for both SEQRES and ATOM records:

>d1a47_4 c.1.8.1 (1-406) Cyclodextrin glycosyltransferase {Thermoanaerobacterium thermosulfurigenes, EM1}
asdtavsnvvnystdviyqivtdrfvdgntsnnptgdlydpthtslkkyfggdwqgiink
indgyltgmgvtaiwisqpveniyavlpdstfggstsyhgywardfkrtnpyfgsftdfq
nlintahahnikviidfapnhtspasetdptyaengrlydngtllggytndtngyfhhyg
gtdfssyedgiyrnlfdladlnqqnstidsylksaikvwldmgidgirldavkhmpfgwq
knfmdsilsyrpvftfgewflgtneidvnntyfanesgmslldfrfsqkvrqvfrdntdt
mygldsmiqstasdynfindmvtfidnhdmdrfynggstrpveqalaftltsrgvpaiyy
gteqymtgngdpynrammtsfntsttaynvikklaplrksnpaiay

Timeline for d1a47_4:

• d1a47_4 first appeared (with stable ids) in SCOP 1.55
  
• d1a47_4 appears in SCOP 1.63
  
• d1a47_4 appears in SCOP 1.67
  
• d1a47_4 appears in the current release, SCOPe 2.08, called d1a47a4