SCOP 1.71: Domain d1dedb4: 1ded B:1-406

Lineage for d1dedb4 (1ded B:1-406)

Root: SCOP 1.71
Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites

Superfamily c.1.8: (Trans)glycosidases [51445] (13 families)

Family c.1.8.1: Amylase, catalytic domain [51446] (24 proteins)
members of the family may contain various insert subdomains
in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain

Protein Cyclodextrin glycosyltransferase [51452] (5 species)
contains two more all-beta domains, one is Immunoglobulin-like and the other is trasthyretin-like
Species Alkalophilic bacillus sp., strain 1011 [51456] (8 PDB entries)
Domain d1dedb4: 1ded B:1-406 [28745]
Other proteins in same PDB: d1deda1, d1deda2, d1deda3, d1dedb1, d1dedb2, d1dedb3
complexed with acr, ca; mutant

Details for d1dedb4

PDB Entry: 1ded (more details), 2 Å

PDB Description: crystal structure of alkalophilic asparagine 233-replaced cyclodextrin glucanotransferase complexed with an inhibitor, acarbose, at 2.0 a resolution

SCOP Domain Sequences for d1dedb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dedb4 c.1.8.1 (B:1-406) Cyclodextrin glycosyltransferase {Alkalophilic bacillus sp., strain 1011}
apdtsvsnkqnfstdviyqiftdrfsdgnpannptgaafdgsctnlrlycggdwqgiink
indgyltgmgitaiwisqpveniysvinysgvnntayhgywardfkktnpaygtmqdfkn
lidtahahnikviidfapnhtspassddpsfaengrlydngnllggytndtqnlfhhygg
tdfstiengiyknlydladlnhnnssvdvylkdaikmwldlgvdgirvdavknmpfgwqk
sfmatinnykpvftfgewflgvneispeyhqfanesgmslldfrfaqkarqvfrdntdnm
yglkamlegsevdyaqvndqvtfidnhdmerfhtsngdrrkleqalaftltsrgvpaiyy
gseqymsggndpdnrarlpsfsttttayqviqklaplrksnpaiay

SCOP Domain Coordinates for d1dedb4:

Click to download the PDB-style file with coordinates for d1dedb4.
(The format of our PDB-style files is described here.)

Timeline for d1dedb4: