Lineage for d1pamb4 (1pam B:1-406)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 64292Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies)
  4. 64720Superfamily c.1.8: (Trans)glycosidases [51445] (8 families) (S)
  5. 64721Family c.1.8.1: alpha-Amylases, N-terminal domain [51446] (12 proteins)
  6. 64770Protein Cyclodextrin glycosyltransferase [51452] (5 species)
  7. 64771Species Alkalophilic bacillus sp., strain 1011 [51456] (4 PDB entries)
  8. 64773Domain d1pamb4: 1pam B:1-406 [28741]
    Other proteins in same PDB: d1pama1, d1pama2, d1pama3, d1pamb1, d1pamb2, d1pamb3

Details for d1pamb4

PDB Entry: 1pam (more details), 1.8 Å

PDB Description: cyclodextrin glucanotransferase

SCOP Domain Sequences for d1pamb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pamb4 c.1.8.1 (B:1-406) Cyclodextrin glycosyltransferase {Alkalophilic bacillus sp., strain 1011}
apdtsvsnkqnfstdviyqiftdrfsdgnpannptgaafdgsctnlrlycggdwqgiink
indgyltgmgitaiwisqpveniysvinysgvnntayhgywardfkktnpaygtmqdfkn
lidtahahnikviidfapnhtspassddpsfaengrlydngnllggytndtqnlfhhygg
tdfstiengiyknlydladlnhnnssvdvylkdaikmwldlgvdgirvdavkhmpfgwqk
sfmatinnykpvftfgewflgvneispeyhqfanesgmslldfrfaqkarqvfrdntdnm
yglkamlegsevdyaqvndqvtfidnhdmerfhtsngdrrkleqalaftltsrgvpaiyy
gseqymsggndpdnrarlpsfsttttayqviqklaplrksnpaiay

SCOP Domain Coordinates for d1pamb4:

Click to download the PDB-style file with coordinates for d1pamb4.
(The format of our PDB-style files is described here.)

Timeline for d1pamb4: