![]() | Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (13 families) ![]() |
![]() | Family c.1.8.1: Amylase, catalytic domain [51446] (24 proteins) members of the family may contain various insert subdomains in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain |
![]() | Protein Cyclodextrin glycosyltransferase [51452] (5 species) contains two more all-beta domains, one is Immunoglobulin-like and the other is trasthyretin-like |
![]() | Species Alkalophilic bacillus sp., strain 1011 [51456] (8 PDB entries) |
![]() | Domain d1pama4: 1pam A:1-406 [28740] Other proteins in same PDB: d1pama1, d1pama2, d1pama3, d1pamb1, d1pamb2, d1pamb3 |
PDB Entry: 1pam (more details), 1.8 Å
SCOP Domain Sequences for d1pama4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pama4 c.1.8.1 (A:1-406) Cyclodextrin glycosyltransferase {Alkalophilic bacillus sp., strain 1011} apdtsvsnkqnfstdviyqiftdrfsdgnpannptgaafdgsctnlrlycggdwqgiink indgyltgmgitaiwisqpveniysvinysgvnntayhgywardfkktnpaygtmqdfkn lidtahahnikviidfapnhtspassddpsfaengrlydngnllggytndtqnlfhhygg tdfstiengiyknlydladlnhnnssvdvylkdaikmwldlgvdgirvdavkhmpfgwqk sfmatinnykpvftfgewflgvneispeyhqfanesgmslldfrfaqkarqvfrdntdnm yglkamlegsevdyaqvndqvtfidnhdmerfhtsngdrrkleqalaftltsrgvpaiyy gseqymsggndpdnrarlpsfsttttayqviqklaplrksnpaiay
Timeline for d1pama4:
![]() Domains from other chains: (mouse over for more information) d1pamb1, d1pamb2, d1pamb3, d1pamb4 |