Lineage for d1qhpa4 (1qhp A:1-407)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies) Superfamily c.1.8: (Trans)glycosidases [51445] (7 families) 
Family c.1.8.1: alpha-Amylases, N-terminal domain [51446] (11 proteins) Protein Cyclodextrin glycosyltransferase [51452] (5 species) Species Bacillus stearothermophilus, maltogenic alpha-amylase [TaxId:1422] [51455] (2 PDB entries) 
Domain d1qhpa4: 1qhp A:1-407 [28739]
Other proteins in same PDB: d1qhpa1, d1qhpa2, d1qhpa3
Details for d1qhpa4
PDB Entry: 1qhp (more details), 1.7 Å
PDB Description: five-domain alpha-amylase from bacillus stearothermophilus, maltose complex
SCOP Domain Sequences for d1qhpa4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qhpa4 c.1.8.1 (A:1-407) Cyclodextrin glycosyltransferase {Bacillus stearothermophilus, maltogenic alpha-amylase}
sssasvkgdviyqiiidrfydgdttnnnpaksyglydptkskwkmywggdlegvrqklpy
lkqlgvttiwlspvldnldtlagtdntgyhgywtrdfkqieehfgnwttfdtlvndahqn
gikvivdfvpnhstpfkandstfaeggalynngtymgnyfddatkgyfhhngdisnwddr
yeaqwknftdpagfsladlsqengtiaqyltdaavqlvahgadglridavkhfnsgfsks
ladklyqkkdiflvgewygddpgtanhlekvryannsgvnvldfdlntvirnvfgtftqt
mydlnnmvnqtgneykykenlitfidnhdmsrflsvnsnkanlhqalafiltsrgtpsiy
ygteqymaggndpynrgmmpafdttttafkevstlaglrrnnaaiqy
SCOP Domain Coordinates for d1qhpa4:
Click to download the PDB-style file with coordinates for d1qhpa4.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qhpa4:
- d1qhpa4 appears in SCOP 1.57
- d1qhpa4 appears in the current release, SCOPe 2.08
View in 3D
