![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) ![]() |
![]() | Family c.1.8.1: Amylase, catalytic domain [51446] (25 proteins) members of the family may contain various insert subdomains in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain |
![]() | Protein Cyclodextrin glycosyltransferase [51452] (6 species) contains two more all-beta domains, one is Immunoglobulin-like and the other is trasthyretin-like |
![]() | Species Bacillus stearothermophilus, maltogenic alpha-amylase [TaxId:1422] [51455] (2 PDB entries) |
![]() | Domain d1qhoa4: 1qho A:1-407 [28738] Other proteins in same PDB: d1qhoa1, d1qhoa2, d1qhoa3 complexed with abd, ca, mal, so4 |
PDB Entry: 1qho (more details), 1.7 Å
SCOP Domain Sequences for d1qhoa4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qhoa4 c.1.8.1 (A:1-407) Cyclodextrin glycosyltransferase {Bacillus stearothermophilus, maltogenic alpha-amylase [TaxId: 1422]} sssasvkgdviyqiiidrfydgdttnnnpaksyglydptkskwkmywggdlegvrqklpy lkqlgvttiwlspvldnldtlagtdntgyhgywtrdfkqieehfgnwttfdtlvndahqn gikvivdfvpnhstpfkandstfaeggalynngtymgnyfddatkgyfhhngdisnwddr yeaqwknftdpagfsladlsqengtiaqyltdaavqlvahgadglridavkhfnsgfsks ladklyqkkdiflvgewygddpgtanhlekvryannsgvnvldfdlntvirnvfgtftqt mydlnnmvnqtgneykykenlitfidnhdmsrflsvnsnkanlhqalafiltsrgtpsiy ygteqymaggndpynrgmmpafdttttafkevstlaglrrnnaaiqy
Timeline for d1qhoa4: