Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) |
Family c.1.8.1: Amylase, catalytic domain [51446] (24 proteins) members of the family may contain various insert subdomains in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain |
Protein Cyclodextrin glycosyltransferase [51452] (5 species) contains two more all-beta domains, one is Immunoglobulin-like and the other is trasthyretin-like |
Species Bacillus stearothermophilus [TaxId:1422] [51454] (1 PDB entry) |
Domain d1cyga4: 1cyg A:1-402 [28737] Other proteins in same PDB: d1cyga1, d1cyga2, d1cyga3 complexed with ca |
PDB Entry: 1cyg (more details), 2.5 Å
SCOP Domain Sequences for d1cyga4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cyga4 c.1.8.1 (A:1-402) Cyclodextrin glycosyltransferase {Bacillus stearothermophilus [TaxId: 1422]} agnlnkvnftsdvvyqivvdrfvdgntsnnpsgalfssgctnlrkycggdwqgiinkind gyltdmgvtaiwisqpvenvfsvmndasgsasyhgywardfkkpnpffgtlsdfqrlvda ahakgikviidfapnhtspasetnpsymengrlydngtllggytndanmyfhhnggttfs sledgiyrnlfdladlnhqnpvidrylkdavkmwidmgidgirmdavkhmpfgwqkslmd eidnyrpvftfgewflsenevdannhyfanesgmslldfrfgqklrqvlrnnsdnwygfn qmiqdtasaydevldqvtfidnhdmdrfmidggdprkvdmalavlltsrgvpniyygteq ymtgngdpnnrkmmssfnkntrayqviqklsslrrnnpalay
Timeline for d1cyga4: