SCOP 1.73: Domain d1cyga4: 1cyg A:1-402

Lineage for d1cyga4 (1cyg A:1-402)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (14 families)

5. Family c.1.8.1: Amylase, catalytic domain [51446] (24 proteins)
   members of the family may contain various insert subdomains
   in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain

6. Protein Cyclodextrin glycosyltransferase [51452] (5 species)
   contains two more all-beta domains, one is Immunoglobulin-like and the other is trasthyretin-like

7. Species Bacillus stearothermophilus [TaxId:1422] [51454] (1 PDB entry)

8. Domain d1cyga4: 1cyg A:1-402 [28737]
   Other proteins in same PDB: d1cyga1, d1cyga2, d1cyga3
   complexed with ca

Details for d1cyga4

PDB Entry: 1cyg, 2.5 Å

PDB Description: cyclodextrin glucanotransferase (e.c.2.4.1.19) (cgtase)

PDB Compounds: (A:) cyclodextrin glucanotransferase

SCOP Domain Sequences for d1cyga4:

Sequence; same for both SEQRES and ATOM records:

>d1cyga4 c.1.8.1 (A:1-402) Cyclodextrin glycosyltransferase {Bacillus stearothermophilus [TaxId: 1422]}
agnlnkvnftsdvvyqivvdrfvdgntsnnpsgalfssgctnlrkycggdwqgiinkind
gyltdmgvtaiwisqpvenvfsvmndasgsasyhgywardfkkpnpffgtlsdfqrlvda
ahakgikviidfapnhtspasetnpsymengrlydngtllggytndanmyfhhnggttfs
sledgiyrnlfdladlnhqnpvidrylkdavkmwidmgidgirmdavkhmpfgwqkslmd
eidnyrpvftfgewflsenevdannhyfanesgmslldfrfgqklrqvlrnnsdnwygfn
qmiqdtasaydevldqvtfidnhdmdrfmidggdprkvdmalavlltsrgvpniyygteq
ymtgngdpnnrkmmssfnkntrayqviqklsslrrnnpalay

Timeline for d1cyga4:

• d1cyga4 first appeared (with stable ids) in SCOP 1.55, called d1cyg_4
  
• d1cyga4 was called d1cyg_4 in SCOP 1.71
  
• d1cyga4 appears in SCOP 1.75
  
• d1cyga4 appears in the current release, SCOPe 2.08