Lineage for d1cxf_4 (1cxf 1-406)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 172678Fold c.1: TIM beta/alpha-barrel [51350] (25 superfamilies)
  4. 173209Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) (S)
  5. 173210Family c.1.8.1: alpha-Amylases, N-terminal domain [51446] (15 proteins)
  6. 173293Protein Cyclodextrin glycosyltransferase [51452] (5 species)
  7. 173303Species Bacillus circulans, different strains [TaxId:1397] [51453] (29 PDB entries)
  8. 173331Domain d1cxf_4: 1cxf 1-406 [28735]
    Other proteins in same PDB: d1cxf_1, d1cxf_2, d1cxf_3

Details for d1cxf_4

PDB Entry: 1cxf (more details), 2.6 Å

PDB Description: complex of a (d229n/e257q) double mutant cgtase from bacillus circulans strain 251 with maltotetraose at 120 k and ph 9.1 obtained after soaking the crystal with alpha-cyclodextrin

SCOP Domain Sequences for d1cxf_4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cxf_4 c.1.8.1 (1-406) Cyclodextrin glycosyltransferase {Bacillus circulans, different strains}
apdtsvsnkqnfstdviyqiftdrfsdgnpannptgaafdgtctnlrlycggdwqgiink
indgyltgmgvtaiwisqpveniysiinysgvnntayhgywardfkktnpaygtiadfqn
liaaahaknikviidfapnhtspassdqpsfaengrlydngtllggytndtqnlfhhngg
tdfsttengiyknlydladlnhnnstvdvylkdaikmwldlgidgirmnavkhmpfgwqk
sfmaavnnykpvftfgqwflgvnevspenhkfanesgmslldfrfaqkvrqvfrdntdnm
yglkamlegsaadyaqvddqvtfidnhdmerfhasnanrrkleqalaftltsrgvpaiyy
gteqymsggtdpdnraripsfststtayqviqklaplrkcnpaiay

SCOP Domain Coordinates for d1cxf_4:

Click to download the PDB-style file with coordinates for d1cxf_4.
(The format of our PDB-style files is described here.)

Timeline for d1cxf_4: