SCOPe 2.07: Domain d1cgua4: 1cgu A:1-406

Lineage for d1cgua4 (1cgu A:1-406)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
   members of the family may contain various insert subdomains
   in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain

6. Protein Cyclodextrin glycosyltransferase [51452] (5 species)
   contains two more all-beta domains, one is Immunoglobulin-like and the other is trasthyretin-like

7. Species Bacillus circulans, different strains [TaxId:1397] [51453] (36 PDB entries)

8. Domain d1cgua4: 1cgu A:1-406 [28732]
   Other proteins in same PDB: d1cgua1, d1cgua2, d1cgua3
   complexed with ca

Details for d1cgua4

PDB Entry: 1cgu, 2.5 Å

PDB Description: catalytic center of cyclodextrin glycosyltransferase derived from x- ray structure analysis combined with site-directed mutagenesis

PDB Compounds: (A:) cyclodextrin glycosyl-transferase

SCOPe Domain Sequences for d1cgua4:

Sequence; same for both SEQRES and ATOM records:

>d1cgua4 c.1.8.1 (A:1-406) Cyclodextrin glycosyltransferase {Bacillus circulans, different strains [TaxId: 1397]}
dpdtavtnkqsfstdviyqvftdrfldgnpsnnptgaaydatcsnlklycggdwqglink
indnyfsdlgvtalwisqpvenifatinysgvtntayhgywardfkktnpyfgtmadfqn
littahakgikividfapnhtspametdtsfaengrlydngtlvggytndtngyfhhngg
sdfsslengiyknlydladfnhnnatidkyfkdaiklwldmgvdgirvaavkhmplgwqk
swmssiyahkpvftfgewflgsaasdadntdfanksgmslldfrfnsavrnvfrdntsnm
yaldsminstatdynqvndqvtfidnhdmdrfktsavnnrrleqalaftltsrgvpaiyy
gteqyltgngdpdnrakmpsfsksttafnvisklaplrksnpaiay

Timeline for d1cgua4:

• d1cgua4 first appeared (with stable ids) in SCOP 1.55, called d1cgu_4
  
• d1cgua4 appears in SCOPe 2.06
  
• d1cgua4 appears in the current release, SCOPe 2.08