SCOP 1.67: Domain d2dij_4: 2dij 1-406

Lineage for d2dij_4 (2dij 1-406)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (10 families)

5. Family c.1.8.1: Amylase, catalytic domain [51446] (24 proteins)
   members of the family may contain various insert subdomains
   in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain

6. Protein Cyclodextrin glycosyltransferase [51452] (5 species)
   contains two more all-beta domains, one is Immunoglobulin-like and the other is trasthyretin-like

7. Species Bacillus circulans, different strains [TaxId:1397] [51453] (36 PDB entries)

8. Domain d2dij_4: 2dij 1-406 [28730]
   Other proteins in same PDB: d2dij_1, d2dij_2, d2dij_3
   complexed with aci, ca, glc, gld; mutant

Details for d2dij_4

PDB Entry: 2dij, 2.6 Å

PDB Description: complex of a y195f mutant cgtase from b. circulans strain 251 complexed with a maltononaose inhibitor at ph 9.8 obtained after soaking the crystal with acarbose and maltohexaose

SCOP Domain Sequences for d2dij_4:

Sequence; same for both SEQRES and ATOM records:

>d2dij_4 c.1.8.1 (1-406) Cyclodextrin glycosyltransferase {Bacillus circulans, different strains}
apdtsvsnkqnfstdviyqiftdrfsdgnpannptgaafdgtctnlrlycggdwqgiink
indgyltgmgvtaiwisqpveniysiinysgvnntayhgywardfkktnpaygtiadfqn
liaaahaknikviidfapnhtspassdqpsfaengrlydngtllggytndtqnlfhhngg
tdfsttengiyknlfdladlnhnnstvdvylkdaikmwldlgidgirmdavkhmpfgwqk
sfmaavnnykpvftfgewflgvnevspenhkfanesgmslldfrfaqkvrqvfrdntdnm
yglkamlegsaadyaqvddqvtfidnhdmerfhasnanrrkleqalaftltsrgvpaiyy
gteqymsggtdpdnraripsfststtayqviqklaplrkcnpaiay

Timeline for d2dij_4:

• d2dij_4 first appeared (with stable ids) in SCOP 1.55
  
• d2dij_4 appears in SCOP 1.65
  
• d2dij_4 appears in SCOP 1.69
  
• d2dij_4 appears in the current release, SCOPe 2.08, called d2dija4