Lineage for d1tcma4 (1tcm A:1-406)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 18710Superfamily c.1.8: (Trans)glycosidases [51445] (7 families) (S)
  5. 18711Family c.1.8.1: alpha-Amylases, N-terminal domain [51446] (11 proteins)
  6. 18748Protein Cyclodextrin glycosyltransferase [51452] (5 species)
  7. 18756Species Bacillus circulans, different strains [TaxId:1397] [51453] (27 PDB entries)
  8. 18773Domain d1tcma4: 1tcm A:1-406 [28727]
    Other proteins in same PDB: d1tcma1, d1tcma2, d1tcma3, d1tcmb1, d1tcmb2, d1tcmb3

Details for d1tcma4

PDB Entry: 1tcm (more details), 2.2 Å

PDB Description: cyclodextrin glycosyltransferase w616a mutant from bacillus circulans strain 251

SCOP Domain Sequences for d1tcma4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tcma4 c.1.8.1 (A:1-406) Cyclodextrin glycosyltransferase {Bacillus circulans, different strains}
apdtsvsnkqnfstdviyqiftdrfsdgnpannptgaafdgtctnlrlycggdwqgiink
indgyltgmgvtaiwisqpveniysiinysgvnntayhgywardfkktnpaygtiadfqn
liaaahaknikviidfapnhtspassdqpsfaengrlydngtllggytndtqnlfhhngg
tdfsttengiyknlydladlnhnnstvdvylkdaikmwldlgidgirmdavkhmpfgwqk
sfmaavnnykpvftfgewflgvnevspenhkfanesgmslldfrfaqkvrqvfrdntdnm
yglkamlegsaadyaqvddqvtfidnhdmerfhasnanrrkleqalaftltsrgvpaiyy
gteqymsggtdpdnraripsfststtayqviqklaplrkcnpaiay

SCOP Domain Coordinates for d1tcma4:

Click to download the PDB-style file with coordinates for d1tcma4.
(The format of our PDB-style files is described here.)

Timeline for d1tcma4: