Lineage for d1cxla4 (1cxl A:1-406)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 473233Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 474052Superfamily c.1.8: (Trans)glycosidases [51445] (11 families) (S)
  5. 474053Family c.1.8.1: Amylase, catalytic domain [51446] (24 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 474230Protein Cyclodextrin glycosyltransferase [51452] (5 species)
    contains two more all-beta domains, one is Immunoglobulin-like and the other is trasthyretin-like
  7. 474248Species Bacillus circulans, different strains [TaxId:1397] [51453] (36 PDB entries)
  8. 474260Domain d1cxla4: 1cxl A:1-406 [28723]
    Other proteins in same PDB: d1cxla1, d1cxla2, d1cxla3

Details for d1cxla4

PDB Entry: 1cxl (more details), 1.81 Å

PDB Description: complex between a covalent intermediate and bacillus circulans strain 251 cgtase e257q

SCOP Domain Sequences for d1cxla4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cxla4 c.1.8.1 (A:1-406) Cyclodextrin glycosyltransferase {Bacillus circulans, different strains}
apdtsvsnkqnfstdviyqiftdrfsdgnpannptgaafdgtctnlrlycggdwqgiink
indgyltgmgvtaiwisqpveniysiinysgvnntayhgywardfkktnpaygtiadfqn
liaaahaknikviidfapnhtspassdqpsfaengrlydngtllggytndtqnlfhhngg
tdfsttengiyknlydladlnhnnstvdvylkdaikmwldlgidgirmdavkhmpfgwqk
sfmaavnnykpvftfgqwflgvnevspenhkfanesgmslldfrfaqkvrqvfrdntdnm
yglkamlegsaadyaqvddqvtfidnhdmerfhasnanrrkleqalaftltsrgvpaiyy
gteqymsggtdpdnraripsfststtayqviqklaplrksnpaiay

SCOP Domain Coordinates for d1cxla4:

Click to download the PDB-style file with coordinates for d1cxla4.
(The format of our PDB-style files is described here.)

Timeline for d1cxla4: