Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) |
Family c.1.8.1: Amylase, catalytic domain [51446] (22 proteins) members of the family may contain various insert subdomains in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain |
Protein Cyclodextrin glycosyltransferase [51452] (5 species) contains two more all-beta domains, one is Immunoglobulin-like and the other is trasthyretin-like |
Species Bacillus circulans, different strains [TaxId:1397] [51453] (31 PDB entries) |
Domain d4cgt_4: 4cgt 1-406 [28719] Other proteins in same PDB: d4cgt_1, d4cgt_2, d4cgt_3 complexed with ca; mutant |
PDB Entry: 4cgt (more details), 2.6 Å
SCOP Domain Sequences for d4cgt_4:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cgt_4 c.1.8.1 (1-406) Cyclodextrin glycosyltransferase {Bacillus circulans, different strains} dpdtavtnkqsfstdviyqvftdrfldgnpsnnptgaaydatcsnlklycggdwqglink indnyfsdlgvtalwisqpvenifatinysgvtntayhgywardfkktnpyfgtmadfqn littahakgikividfapnhtspadaengrlydngtlvggytndtngyfhhnggsdfssl engiyknlydladfnhnnatidkyfkdaiklwldmgvdgirvdavkhmplgwqkswmssi yahkpvftfgewflgsaasdadntdfanksgmslldfrfnsavrnvfrdntsnmyaldsm instatdynqvndqvtfidnhdmdrfktsavnnrrleqalaftltsrgvpaiyygteqyl tgngdpdnrakmpsfsksttafnvisklaplrksnpaiay
Timeline for d4cgt_4: