Lineage for d1cxh_4 (1cxh 1-406)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (24 superfamilies) Superfamily c.1.8: (Trans)glycosidases [51445] (8 families) 
Family c.1.8.1: alpha-Amylases, N-terminal domain [51446] (12 proteins) 
Protein Cyclodextrin glycosyltransferase [51452] (5 species) 
Species Bacillus circulans, different strains [TaxId:1397] [51453] (27 PDB entries) 
Domain d1cxh_4: 1cxh 1-406 [28715]
Other proteins in same PDB: d1cxh_1, d1cxh_2, d1cxh_3
Details for d1cxh_4
PDB Entry: 1cxh (more details), 2.4 Å
PDB Description: complex of cgtase with maltotetraose at room temperature and ph 9.6 based on diffraction data of a crystal soaked with maltoheptaose
SCOP Domain Sequences for d1cxh_4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cxh_4 c.1.8.1 (1-406) Cyclodextrin glycosyltransferase {Bacillus circulans, different strains}
apdtsvsnkqnfstdviyqiftdrfsdgnpannptgaafdgtctnlrlycggdwqgiink
indgyltgmgvtaiwisqpveniysiinysgvnntayhgywardfkktnpaygtiadfqn
liaaahaknikviidfapnhtspassdqpsfaengrlydngtllggytndtqnlfhhngg
tdfsttengiyknlydladlnhnnstvdvylkdaikmwldlgidgirmdavkhmpfgwqk
sfmaavnnykpvftfgewflgvnevspenhkfanesgmslldfrfaqkvrqvfrdntdnm
yglkamlegsaadyaqvddqvtfidnhdmerfhasnanrrkleqalaftltsrgvpaiyy
gteqymsggtdpdnraripsfststtayqviqklaplrkcnpaiay
SCOP Domain Coordinates for d1cxh_4:
Click to download the PDB-style file with coordinates for d1cxh_4.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1cxh_4:
- d1cxh_4 first appeared (with stable ids) in SCOP 1.55
- d1cxh_4 appears in SCOP 1.59
- d1cxh_4 appears in the current release, SCOPe 2.08, called d1cxha4
View in 3D
