Lineage for d1cgv_4 (1cgv 1-406)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 172678Fold c.1: TIM beta/alpha-barrel [51350] (25 superfamilies)
  4. 173209Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) (S)
  5. 173210Family c.1.8.1: alpha-Amylases, N-terminal domain [51446] (15 proteins)
  6. 173293Protein Cyclodextrin glycosyltransferase [51452] (5 species)
  7. 173303Species Bacillus circulans, different strains [TaxId:1397] [51453] (29 PDB entries)
  8. 173315Domain d1cgv_4: 1cgv 1-406 [28714]
    Other proteins in same PDB: d1cgv_1, d1cgv_2, d1cgv_3

Details for d1cgv_4

PDB Entry: 1cgv (more details), 2.5 Å

PDB Description: site directed mutations of the active site residue tyrosine 195 of cyclodextrin glycosyltransferase from bacillus circulans strain 251 affecting activity and product specificity

SCOP Domain Sequences for d1cgv_4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cgv_4 c.1.8.1 (1-406) Cyclodextrin glycosyltransferase {Bacillus circulans, different strains}
apdtsvsnkqnfstdviyqiftdrfsdgnpannptgaafdgtctnlrlycggdwqgiink
indgyltgmgvtaiwisqpveniysiinysgvnntayhgywardfkktnpaygtiadfqn
liaaahaknikviidfapnhtspassdqpsfaengrlydngtllggytndtqnlfhhngg
tdfsttengiyknlfdladlnhnnstvdvylkdaikmwldlgidgirmdavkhmpfgwqk
sfmaavnnykpvftfgewflgvnevspenhkfanesgmslldfrfaqkvrqvfrdntdnm
yglkamlegsaadyaqvddqvtfidnhdmerfhasnanrrkleqalaftltsrgvpaiyy
gteqymsggtdpdnraripsfststtayqviqklaplrkcnpaiay

SCOP Domain Coordinates for d1cgv_4:

Click to download the PDB-style file with coordinates for d1cgv_4.
(The format of our PDB-style files is described here.)

Timeline for d1cgv_4: