Lineage for d1hvxa2 (1hvx A:1-393)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 18710Superfamily c.1.8: (Trans)glycosidases [51445] (7 families) (S)
  5. 18711Family c.1.8.1: alpha-Amylases, N-terminal domain [51446] (11 proteins)
  6. 18735Protein Bacterial alpha-amylase [51447] (4 species)
  7. 18744Species Bacillus stearothermophilus [TaxId:1422] [51451] (1 PDB entry)
  8. 18745Domain d1hvxa2: 1hvx A:1-393 [28708]
    Other proteins in same PDB: d1hvxa1

Details for d1hvxa2

PDB Entry: 1hvx (more details), 2 Å

PDB Description: bacillus stearothermophilus alpha-amylase
PDB Compounds: (A:)

SCOP Domain Sequences for d1hvxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hvxa2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Bacillus stearothermophilus}
aapfngtmmqyfewylpddgtlwtkvaneannlsslgitalwlppaykgtsrsdvgygvy
dlydlgefnqkgavrtkygtkaqylqaiqaahaagmqvyadvvfdhkggadgtewvdave
vnpsdrnqeisgtyqiqawtkfdfpgrgntyssfkwrwyhfdgvdwdesrklsriykfrg
igkawdwevdtengnydylmyadldmdhpevvtelkswgkwyvnttnidgfrldavkhik
fsffpdwlsyvrsqtgkplftvgeywsydinklhnyimktngtmslfdaplhnkfytask
sggtfdmrtlmtntlmkdqptlavtfvdnhdtepgqalqswvdpwfkplayafiltrqeg
ypcvfygdyygipqynipslkskidplliarrd

SCOP Domain Coordinates for d1hvxa2:

Click to download the PDB-style file with coordinates for d1hvxa2.
(The format of our PDB-style files is described here.)

Timeline for d1hvxa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hvxa1