SCOPe 2.07: Domain d2fp7a1: 2fp7 A:50-88

Lineage for d2fp7a1 (2fp7 A:50-88)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.96: Flavivirus non-structural protein NS2B-like [310561] (1 superfamily)

4. Superfamily g.96.1: Flavivirus non-structural protein NS2B-like [310588] (2 families)
   Pfam PF01002; see PubMed 16532006 for discussion of NS2B-NS3pro complex

5. Family g.96.1.1: Flavivirus non-structural protein NS2B-like [310635] (2 proteins)

6. Protein Flavivirus non-structural protein NS2B [310766] (2 species)

7. Species West Nile virus [TaxId:11082] [311022] (1 PDB entry)

8. Domain d2fp7a1: 2fp7 A:50-88 [287072]
   Other proteins in same PDB: d2fp7a2, d2fp7b1

Details for d2fp7a1

PDB Entry: 2fp7, 1.68 Å

PDB Description: west nile virus ns2b/ns3protease in complex with bz-nle-lys-arg-arg-h

PDB Compounds: (A:) Genome polyprotein

SCOPe Domain Sequences for d2fp7a1:

Sequence; same for both SEQRES and ATOM records:

>d2fp7a1 g.96.1.1 (A:50-88) Flavivirus non-structural protein NS2B {West Nile virus [TaxId: 11082]}
tdmwiertaditwesdaeitgsservdvrldddgnfqlm

Timeline for d2fp7a1:

• d2fp7a1 first appeared in SCOPe 2.06
  
• d2fp7a1 appears in the current release, SCOPe 2.08