![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.96: Flavivirus non-structural protein NS2B-like [310561] (1 superfamily) |
![]() | Superfamily g.96.1: Flavivirus non-structural protein NS2B-like [310588] (2 families) ![]() Pfam PF01002; see PubMed 16532006 for discussion of NS2B-NS3pro complex |
![]() | Family g.96.1.1: Flavivirus non-structural protein NS2B-like [310635] (2 proteins) |
![]() | Protein Flavivirus non-structural protein NS2B [310766] (2 species) |
![]() | Species West Nile virus [TaxId:11082] [311022] (1 PDB entry) |
![]() | Domain d2fp7a1: 2fp7 A:50-88 [287072] Other proteins in same PDB: d2fp7a2, d2fp7b1 |
PDB Entry: 2fp7 (more details), 1.68 Å
SCOPe Domain Sequences for d2fp7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fp7a1 g.96.1.1 (A:50-88) Flavivirus non-structural protein NS2B {West Nile virus [TaxId: 11082]} tdmwiertaditwesdaeitgsservdvrldddgnfqlm
Timeline for d2fp7a1: