Lineage for d2fp7a1 (2fp7 A:50-88)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3039002Fold g.96: Flavivirus non-structural protein NS2B-like [310561] (1 superfamily)
  4. 3039003Superfamily g.96.1: Flavivirus non-structural protein NS2B-like [310588] (2 families) (S)
    Pfam PF01002; see PubMed 16532006 for discussion of NS2B-NS3pro complex
  5. 3039004Family g.96.1.1: Flavivirus non-structural protein NS2B-like [310635] (2 proteins)
  6. 3039005Protein Flavivirus non-structural protein NS2B [310766] (2 species)
  7. 3039008Species West Nile virus [TaxId:11082] [311022] (1 PDB entry)
  8. 3039009Domain d2fp7a1: 2fp7 A:50-88 [287072]
    Other proteins in same PDB: d2fp7a2, d2fp7b1

Details for d2fp7a1

PDB Entry: 2fp7 (more details), 1.68 Å

PDB Description: west nile virus ns2b/ns3protease in complex with bz-nle-lys-arg-arg-h
PDB Compounds: (A:) Genome polyprotein

SCOPe Domain Sequences for d2fp7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fp7a1 g.96.1.1 (A:50-88) Flavivirus non-structural protein NS2B {West Nile virus [TaxId: 11082]}
tdmwiertaditwesdaeitgsservdvrldddgnfqlm

SCOPe Domain Coordinates for d2fp7a1:

Click to download the PDB-style file with coordinates for d2fp7a1.
(The format of our PDB-style files is described here.)

Timeline for d2fp7a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fp7a2
View in 3D
Domains from other chains:
(mouse over for more information)
d2fp7b1