Lineage for d1bag_2 (1bag 1-347)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 18353Fold c.1: TIM beta/alpha-barrel [51350] (23 superfamilies)
  4. 18710Superfamily c.1.8: (Trans)glycosidases [51445] (7 families) (S)
  5. 18711Family c.1.8.1: alpha-Amylases, N-terminal domain [51446] (11 proteins)
  6. 18735Protein Bacterial alpha-amylase [51447] (4 species)
  7. 18746Species Bacillus subtilis [TaxId:1423] [51450] (1 PDB entry)
  8. 18747Domain d1bag_2: 1bag 1-347 [28707]
    Other proteins in same PDB: d1bag_1

Details for d1bag_2

PDB Entry: 1bag (more details), 2.5 Å

PDB Description: alpha-amylase from bacillus subtilis complexed with maltopentaose
PDB Compounds: ( :)

SCOP Domain Sequences for d1bag_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bag_2 c.1.8.1 (1-347) Bacterial alpha-amylase {Bacillus subtilis}
ltapsiksgtilhawnwsfntlkhnmkdihdagytaiqtspinqvkegnqgdksmsnwyw
lyqptsyqignrylgteqefkemcaaaeeygikvivdavinhttfdyaaisnevksipnw
thgntqiknwsdrwdvtqnsllglydwntqntqvqsylkrfleralndgadgfrfdaakh
ielpddgsygsqfwpnitntsaefqygqilqdsasrdaayanymdvtasnyghsirsalk
nrnlgvsnishyasdvsadklvtwveshdtyanddeestwmsdddirlgwaviasrsgst
plffsrpegggngvrfpgksqigdrgsalfedqaitavnrfhnvmag

SCOP Domain Coordinates for d1bag_2:

Click to download the PDB-style file with coordinates for d1bag_2.
(The format of our PDB-style files is described here.)

Timeline for d1bag_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bag_1